++ rg -v '#' /usr/share/zoneinfo/zone.tab
++ awk '{print $3}'
++ shuf
++ head -n1
+ TZ=Europe/Amsterdam
Choosen random timezone Europe/Amsterdam
+ echo 'Choosen random timezone Europe/Amsterdam'
+ ln -snf /usr/share/zoneinfo/Europe/Amsterdam /etc/localtime
+ echo Europe/Amsterdam
+ dpkg -i package_folder/clickhouse-common-static_24.3.5.48.altinityfips+ubsan_amd64.deb
Selecting previously unselected package clickhouse-common-static.
(Reading database ... 49067 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static_24.3.5.48.altinityfips+ubsan_amd64.deb ...
Unpacking clickhouse-common-static (24.3.5.48.altinityfips+ubsan) ...
Setting up clickhouse-common-static (24.3.5.48.altinityfips+ubsan) ...
+ dpkg -i package_folder/clickhouse-common-static-dbg_24.3.5.48.altinityfips+ubsan_amd64.deb
Selecting previously unselected package clickhouse-common-static-dbg.
(Reading database ... 49096 files and directories currently installed.)
Preparing to unpack .../clickhouse-common-static-dbg_24.3.5.48.altinityfips+ubsan_amd64.deb ...
Unpacking clickhouse-common-static-dbg (24.3.5.48.altinityfips+ubsan) ...
Setting up clickhouse-common-static-dbg (24.3.5.48.altinityfips+ubsan) ...
+ dpkg -i package_folder/clickhouse-server_24.3.5.48.altinityfips+ubsan_amd64.deb
Selecting previously unselected package clickhouse-server.
(Reading database ... 49105 files and directories currently installed.)
Preparing to unpack .../clickhouse-server_24.3.5.48.altinityfips+ubsan_amd64.deb ...
Unpacking clickhouse-server (24.3.5.48.altinityfips+ubsan) ...
Setting up clickhouse-server (24.3.5.48.altinityfips+ubsan) ...
Cannot set 'net_admin' or 'ipc_lock' or 'sys_nice' or 'net_bind_service' capability for clickhouse binary. This is optional. Taskstats accounting will be disabled. To enable taskstats accounting you may add the required capability later manually.
ClickHouse binary is already located at /usr/bin/clickhouse
Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse.
Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse.
Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse.
Creating symlink /usr/bin/ch to /usr/bin/clickhouse.
Creating symlink /usr/bin/chl to /usr/bin/clickhouse.
Creating symlink /usr/bin/chc to /usr/bin/clickhouse.
Creating clickhouse group if it does not exist.
groupadd -r clickhouse
Creating clickhouse user if it does not exist.
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse
Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf.
Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration.
Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration.
Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it.
/etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path.
/etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path.
Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it.
Log directory /var/log/clickhouse-server/ already exists.
Creating data directory /var/lib/clickhouse/.
Creating pid directory /var/run/clickhouse-server.
chown -R clickhouse:clickhouse '/var/log/clickhouse-server/'
chown -R clickhouse:clickhouse '/var/run/clickhouse-server'
chown clickhouse:clickhouse '/var/lib/clickhouse/'
groupadd -r clickhouse-bridge
useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge'
chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge'
Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it.
Setting capabilities for clickhouse binary. This is optional.
chown -R clickhouse:clickhouse '/etc/clickhouse-server'
ClickHouse has been successfully installed.
Start clickhouse-server with:
sudo clickhouse start
Start clickhouse-client with:
clickhouse-client
+ dpkg -i package_folder/clickhouse-client_24.3.5.48.altinityfips+ubsan_amd64.deb
Selecting previously unselected package clickhouse-client.
(Reading database ... 49122 files and directories currently installed.)
Preparing to unpack .../clickhouse-client_24.3.5.48.altinityfips+ubsan_amd64.deb ...
Unpacking clickhouse-client (24.3.5.48.altinityfips+ubsan) ...
Setting up clickhouse-client (24.3.5.48.altinityfips+ubsan) ...
+ echo ''
+ [[ -z '' ]]
+ ch --query 'SELECT 1'
1
+ chl --query 'SELECT 1'
1
+ chc --version
ClickHouse client version 24.3.5.48.altinityfips (altinity build).
+ ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test
+ source /attach_gdb.lib
++ source /utils.lib
+ source /utils.lib
+ /usr/share/clickhouse-test/config/install.sh
+ DEST_SERVER_PATH=/etc/clickhouse-server
+ DEST_CLIENT_PATH=/etc/clickhouse-client
+++ dirname /usr/share/clickhouse-test/config/install.sh
++ cd /usr/share/clickhouse-test/config
++ pwd -P
Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server
+ SRC_PATH=/usr/share/clickhouse-test/config
+ echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server'
+ mkdir -p /etc/clickhouse-server/config.d/
+ mkdir -p /etc/clickhouse-server/users.d/
+ mkdir -p /etc/clickhouse-client
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/reverse_dns_query_function.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/
+ '[' /etc/clickhouse-server = /etc/clickhouse-server ']'
+ ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/
+ [[ -n '' ]]
+ ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/
+ ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/
+ ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/
+ [[ -n '' ]]
+ rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml
+ ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/
+ value=0
+ sed --follow-symlinks -i 's|[01]|0|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=24203264
+ sed --follow-symlinks -i 's|[[:digit:]]\+|24203264|' /etc/clickhouse-server/config.d/keeper_port.xml
+ value=13133824
+ sed --follow-symlinks -i 's|[[:digit:]]\+|13133824|' /etc/clickhouse-server/config.d/keeper_port.xml
+ [[ -n '' ]]
+ [[ -n '' ]]
+ [[ -n '' ]]
+ ARM=aarch64
++ uname -m
+ OS=x86_64
+ [[ -n 1 ]]
+ echo x86_64
x86_64
Adding azure configuration
+ [[ '' -eq 1 ]]
+ [[ x86_64 == \a\a\r\c\h\6\4 ]]
+ echo 'Adding azure configuration'
+ ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/
+ ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/
+ [[ -n '' ]]
+ ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml
+ [[ -n '' ]]
+ ./setup_minio.sh stateless
+ azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log
+ export MINIO_ROOT_USER=clickhouse
+ MINIO_ROOT_USER=clickhouse
+ export MINIO_ROOT_PASSWORD=clickhouse
+ MINIO_ROOT_PASSWORD=clickhouse
+ main stateless
+ local query_dir
++ check_arg stateless
++ local query_dir
++ '[' '!' 1 -eq 1 ']'
++ case "$1" in
++ query_dir=0_stateless
++ echo 0_stateless
+ query_dir=0_stateless
+ '[' '!' -f ./minio ']'
+ start_minio
+ mkdir -p ./minio_data
+ ./minio --version
Azurite Blob service is starting on 0.0.0.0:10000
Azurite Blob service successfully listens on http://0.0.0.0:10000
minio version RELEASE.2022-01-03T18-22-58Z
+ wait_for_it
+ local counter=0
+ local max_counter=60
+ local url=http://localhost:11111
+ params=('--silent' '--verbose')
+ local params
+ ./minio server --address :11111 ./minio_data
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
trying to connect to minio
+ [[ 0 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
+ counter=1
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
+ [[ 1 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
+ counter=2
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
+ [[ 2 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
+ counter=3
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
+ [[ 3 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
+ counter=4
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
+ [[ 4 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
+ counter=5
+ grep AccessDenied
+ curl --silent --verbose http://localhost:11111
+ [[ 5 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
+ counter=6
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
+ [[ 6 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
+ counter=7
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
+ [[ 7 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
+ counter=8
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
trying to connect to minio
+ [[ 8 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
+ counter=9
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
+ [[ 9 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
trying to connect to minio
+ counter=10
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
trying to connect to minio
+ [[ 10 == \6\0 ]]
+ echo 'trying to connect to minio'
+ sleep 1
API: http://172.17.0.2:11111 http://127.0.0.1:11111
Console: http://172.17.0.2:41971 http://127.0.0.1:41971
Documentation: https://docs.min.io
WARNING: Console endpoint is listening on a dynamic port (41971), please use --console-address ":PORT" to choose a static port.
+ counter=11
+ curl --silent --verbose http://localhost:11111
+ grep AccessDenied
AccessDeniedAccess Denied./17F0CA914571F8469fe974ec-c5cf-41d2-b5ad-be6b389a7881
+ lsof -i :11111
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
minio 257 root 10u IPv6 36312 0t0 TCP *:11111 (LISTEN)
+ sleep 5
+ setup_minio stateless
+ local test_type=stateless
+ ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse
Added `clickminio` successfully.
+ ./mc admin user add clickminio test testtest
Added user `test` successfully.
+ ./mc admin policy set clickminio readwrite user=test
Policy `readwrite` is set on user `test`
+ ./mc mb clickminio/test
Bucket created successfully `clickminio/test`.
+ '[' stateless = stateless ']'
+ ./mc policy set public clickminio/test
Access permission for `clickminio/test` is set to `public`
+ upload_data 0_stateless /usr/share/clickhouse-test
+ local query_dir=0_stateless
+ local test_path=/usr/share/clickhouse-test
+ local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio
++ ls /usr/share/clickhouse-test/queries/0_stateless/data_minio
02366_data.jsonl
+ for file in $(ls "${data_path}")
+ echo 02366_data.jsonl
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl clickminio/test/02366_data.jsonl
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl`
Total: 0 B, Transferred: 0 B, Speed: 0 B/s
02731.arrow
+ for file in $(ls "${data_path}")
+ echo 02731.arrow
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow clickminio/test/02731.arrow
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow`
Total: 0 B, Transferred: 3.82 MiB, Speed: 81.74 MiB/s
02731.parquet
+ for file in $(ls "${data_path}")
+ echo 02731.parquet
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet clickminio/test/02731.parquet
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet`
Total: 0 B, Transferred: 1.57 MiB, Speed: 91.09 MiB/s
+ for file in $(ls "${data_path}")
+ echo 02876.parquet
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet clickminio/test/02876.parquet
02876.parquet
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet`
Total: 0 B, Transferred: 293 B, Speed: 35.87 KiB/s
a.tsv
+ for file in $(ls "${data_path}")
+ echo a.tsv
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv clickminio/test/a.tsv
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv`
Total: 0 B, Transferred: 24 B, Speed: 3.36 KiB/s
+ for file in $(ls "${data_path}")
+ echo b.tsv
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv clickminio/test/b.tsv
b.tsv
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv`
Total: 0 B, Transferred: 33 B, Speed: 3.84 KiB/s
c.tsv
+ for file in $(ls "${data_path}")
+ echo c.tsv
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv clickminio/test/c.tsv
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv`
Total: 0 B, Transferred: 33 B, Speed: 4.93 KiB/s
+ for file in $(ls "${data_path}")
+ echo tsv_with_header.tsv
+ ./mc cp /usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv clickminio/test/tsv_with_header.tsv
tsv_with_header.tsv
`/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv`
Total: 0 B, Transferred: 44 B, Speed: 6.31 KiB/s
+ setup_aws_credentials
+ local minio_root_user=clickhouse
+ local minio_root_password=clickhouse
+ mkdir -p /root/.aws
+ cat
+ ./setup_hdfs_minicluster.sh
+ ls -lha
total 135M
drwxr-xr-x 1 root root 4.0K Aug 31 12:49 .
drwxr-xr-x 1 root root 4.0K Aug 31 12:49 ..
-rw-rw-r-- 1 1000 1000 312 Aug 31 12:47 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 1.6K Jun 13 05:03 attach_gdb.lib
-rw-r--r-- 1 root root 1.3K Aug 31 12:49 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 3.9K Aug 31 12:49 __azurite_db_blob__.json
-rw-r--r-- 1 root root 1.4K Aug 31 12:49 azurite_log
lrwxrwxrwx 1 root root 7 Apr 27 04:02 bin -> usr/bin
drwxr-xr-x 2 root root 4.0K Aug 31 12:49 __blobstorage__
drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot
drwxr-xr-x 5 root root 340 Aug 31 12:48 dev
-rwxr-xr-x 1 root root 0 Aug 31 12:48 .dockerenv
drwxr-xr-x 1 root root 4.0K Aug 31 12:49 etc
drwxr-xr-x 10 1000 1000 4.0K Jun 15 2021 hadoop-3.3.1
drwxr-xr-x 2 root root 4.0K Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Apr 27 04:02 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Apr 27 04:02 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Apr 27 04:02 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Apr 27 04:02 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 21M Jun 13 05:04 mc
drwxr-xr-x 2 root root 4.0K Apr 27 04:02 media
-rwxr-xr-x 1 root root 114M Jun 13 05:04 minio
drwxr-xr-x 4 root root 4.0K Aug 31 12:49 minio_data
drwxr-xr-x 2 root root 4.0K Apr 27 04:02 mnt
drwxr-xr-x 2 root root 4.0K Apr 27 04:02 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4.0K Aug 31 12:48 package_folder
dr-xr-xr-x 839 root root 0 Aug 31 12:48 proc
-rwxrwxr-x 1 root root 7.9K May 14 19:27 process_functional_tests_result.py
drwx------ 1 root root 4.0K Aug 31 12:49 root
drwxr-xr-x 1 root root 4.0K Aug 31 12:49 run
-rwxrwxr-x 1 root root 16K Jun 13 05:03 run.sh
lrwxrwxrwx 1 root root 8 Apr 27 04:02 sbin -> usr/sbin
-rwxrwxr-x 1 root root 11K May 14 19:27 setup_export_logs.sh
-rwxrwxr-x 1 root root 351 Jun 13 05:03 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3.4K Jun 13 05:03 setup_minio.sh
drwxr-xr-x 2 root root 4.0K Apr 27 04:02 srv
-rw-rw-r-- 1 root root 13K Jun 13 05:03 stress_tests.lib
dr-xr-xr-x 13 root root 0 Aug 31 12:48 sys
drwxrwxr-x 2 1000 1000 4.0K Aug 31 12:48 test_output
drwxrwxrwt 1 root root 4.0K Aug 31 12:49 tmp
drwxr-xr-x 1 root root 4.0K Apr 27 04:02 usr
-rw-rw-r-- 1 root root 833 Jun 13 05:03 utils.lib
drwxr-xr-x 1 root root 4.0K Apr 27 04:05 var
+ cd hadoop-3.3.1
+ export JAVA_HOME=/usr
+ JAVA_HOME=/usr
+ mkdir -p target/test/data
+ chown clickhouse ./target/test/data
+ nc -z localhost 12222
+ sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222
+ sleep 1
+ nc -z localhost 12222
+ sleep 1
+ nc -z localhost 12222
+ lsof -i :12222
COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME
java 540 clickhouse 322u IPv4 46145 0t0 TCP localhost:12222 (LISTEN)
+ sleep 5
+ config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ [[ -n '' ]]
+ '[' 1 -gt 1 ']'
+ sudo clickhouse start
127.0.0.1 - - [31/Aug/2024:10:49:56 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:10:49:56 +0000] "PUT /devstoreaccount1/cont/hvgfrnnhmteuorlqbfsqosxuiennvodc?blockid=nyyzpvjxdcrcefcluijofnepfhtnoczflrbomiqtabzhpccvsgaegssxkhuyrwdv&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:10:49:56 +0000] "PUT /devstoreaccount1/cont/hvgfrnnhmteuorlqbfsqosxuiennvodc?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:10:49:56 +0000] "GET /devstoreaccount1/cont/hvgfrnnhmteuorlqbfsqosxuiennvodc HTTP/1.1" 206 4
127.0.0.1 - - [31/Aug/2024:10:49:56 +0000] "GET /devstoreaccount1/cont/hvgfrnnhmteuorlqbfsqosxuiennvodc HTTP/1.1" 206 2
127.0.0.1 - - [31/Aug/2024:10:49:56 +0000] "DELETE /devstoreaccount1/cont/hvgfrnnhmteuorlqbfsqosxuiennvodc HTTP/1.1" 202 -
chown -R clickhouse: '/var/run/clickhouse-server/'
Will run sudo --preserve-env -u 'clickhouse' /usr/bin/clickhouse-server --config-file /etc/clickhouse-server/config.xml --pid-file /var/run/clickhouse-server/clickhouse-server.pid --daemon
Waiting for server to start
Waiting for server to start
Server started
+ [[ -n '' ]]
+ for _ in {1..100}
+ clickhouse-client --query 'SELECT 1'
1
+ break
+ setup_logs_replication
+ set +x
File /tmp/export-logs-config.sh does not exist, do not setup
+ attach_gdb_to_clickhouse
++ kill -l SIGRTMIN
+ RTMIN=34
+ echo '
set follow-fork-mode parent
handle SIGHUP nostop noprint pass
handle SIGINT nostop noprint pass
handle SIGQUIT nostop noprint pass
handle SIGPIPE nostop noprint pass
handle SIGTERM nostop noprint pass
handle SIGUSR1 nostop noprint pass
handle SIGUSR2 nostop noprint pass
handle SIG34 nostop noprint pass
info signals
continue
backtrace full
thread apply all backtrace full
info registers
disassemble /s
up
disassemble /s
up
disassemble /s
p "done"
detach
quit
'
+ sleep 5
+ ts '%Y-%m-%d %H:%M:%S'
++ cat /var/run/clickhouse-server/clickhouse-server.pid
+ gdb -batch -command script.gdb -p 728
+ run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
+ [[ aehxB =~ e ]]
+ set_e=true
+ set +e
+ local total_retries=60
+ shift
+ local retry=0
+ '[' 0 -ge 60 ']'
+ clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\'''
Connected to clickhouse-server after attaching gdb
+ true
+ set -e
+ return
+ export -f run_tests
+ '[' 1 -gt 1 ']'
+ timeout_with_logging 9720 bash -c run_tests
+ local exit_code=0
+ timeout 9720 bash -c run_tests
+ read -ra ADDITIONAL_OPTIONS
+ HIGH_LEVEL_COVERAGE=YES
+ '[' 1 -gt 1 ']'
+ [[ -n '' ]]
+ [[ -n '' ]]
++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\'''
+ [[ 1 == 0 ]]
+ ADDITIONAL_OPTIONS+=('--jobs')
+ ADDITIONAL_OPTIONS+=('8')
+ [[ -n 0 ]]
+ [[ -n 2 ]]
+ ADDITIONAL_OPTIONS+=('--run-by-hash-num')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_NUM")
+ ADDITIONAL_OPTIONS+=('--run-by-hash-total')
+ ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_TOTAL")
+ HIGH_LEVEL_COVERAGE=NO
+ [[ -n '' ]]
+ [[ NO = \Y\E\S ]]
+ ADDITIONAL_OPTIONS+=('--report-logs-stats')
+ try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ local total_retries=10
+ shift
+ fn_exists run_with_retry
+ declare -F run_with_retry
+ run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ [[ hxBc =~ e ]]
+ set_e=false
+ set +e
+ local total_retries=10
+ shift
+ local retry=0
+ '[' 0 -ge 10 ']'
+ clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')'
+ false
+ return
+ set +e
+ clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --test-runs 1 --hung-check --print-time --jobs 8 --run-by-hash-num 0 --run-by-hash-total 2 --report-logs-stats
+ ts '%Y-%m-%d %H:%M:%S'
+ tee -a test_output/test_result.txt
2024-08-31 12:50:46 Using queries from '/usr/share/clickhouse-test/queries' directory
2024-08-31 12:50:46 Connecting to ClickHouse server... OK
2024-08-31 12:50:46 Connected to server 24.3.5.48.altinityfips @ f030c602050d371934c7b7609b7a8228fb1c7779 HEAD
2024-08-31 12:50:46 Found 2864 parallel tests and 302 sequential tests
2024-08-31 12:50:47
2024-08-31 12:50:47 Running about 358 stateless tests (ForkPoolWorker-2).
2024-08-31 12:50:47
2024-08-31 12:50:47 03196_max_intersections_arena_crash: [ OK ] 0.30 sec.
2024-08-31 12:50:47
2024-08-31 12:50:47 Running about 358 stateless tests (ForkPoolWorker-3).
2024-08-31 12:50:47
2024-08-31 12:50:47 03166_mv_prewhere_duplicating_name_bug: [ OK ] 0.31 sec.
2024-08-31 12:50:47
2024-08-31 12:50:47 Running about 358 stateless tests (ForkPoolWorker-5).
2024-08-31 12:50:47
2024-08-31 12:50:47 03165_order_by_duplicate: [ OK ] 0.34 sec.
2024-08-31 12:50:47
2024-08-31 12:50:47 Running about 358 stateless tests (ForkPoolWorker-6).
2024-08-31 12:50:47
2024-08-31 12:50:47 03165_distinct_with_window_func_crash: [ OK ] 0.35 sec.
2024-08-31 12:50:47
2024-08-31 12:50:47 Running about 358 stateless tests (ForkPoolWorker-8).
2024-08-31 12:50:47
2024-08-31 12:50:47 03152_analyzer_columns_list: [ OK ] 0.37 sec.
2024-08-31 12:50:47
2024-08-31 12:50:47 Running about 358 stateless tests (ForkPoolWorker-7).
2024-08-31 12:50:47
2024-08-31 12:50:47 03151_pmj_join_non_procssed_clash: [ OK ] 0.42 sec.
2024-08-31 12:50:47
2024-08-31 12:50:47 Running about 358 stateless tests (ForkPoolWorker-4).
2024-08-31 12:50:47
2024-08-31 12:50:47 03164_analyzer_validate_tree_size: [ OK ] 0.44 sec.
2024-08-31 12:50:47 03142_untuple_crash: [ OK ] 0.21 sec.
2024-08-31 12:50:47 03142_alter_comment_parameterized_view: [ OK ] 0.22 sec.
2024-08-31 12:50:47 03131_rewrite_sum_if_nullable: [ OK ] 0.24 sec.
2024-08-31 12:50:47 03143_parallel_replicas_mat_view_bug: [ OK ] 0.25 sec.
2024-08-31 12:50:47 03129_cte_with_final: [ OK ] 0.26 sec.
2024-08-31 12:50:47 03127_argMin_combinator_state: [ OK ] 0.24 sec.
2024-08-31 12:50:47 03093_bug_gcd_codec: [ OK ] 0.31 sec.
2024-08-31 12:50:47 03033_final_undefined_last_mark: [ OK ] 0.18 sec.
2024-08-31 12:50:47 03038_move_partition_to_oneself_deadlock: [ OK ] 0.24 sec.
2024-08-31 12:50:47 03032_scalars_create_as_select: [ OK ] 0.22 sec.
2024-08-31 12:50:47 03031_input_format_allow_errors_num_bad_escape_sequence: [ OK ] 0.20 sec.
2024-08-31 12:50:47 03023_remove_unused_column_distinct: [ OK ] 0.21 sec.
2024-08-31 12:50:47 03033_analyzer_resolve_from_parent_scope: [ OK ] 0.31 sec.
2024-08-31 12:50:48 03022_alter_materialized_view_query_has_inner_table: [ OK ] 0.27 sec.
2024-08-31 12:50:48 03019_numbers_pretty: [ OK ] 0.22 sec.
2024-08-31 12:50:48 03018_analyzer_distributed_query_with_positional_arguments: [ OK ] 0.23 sec.
2024-08-31 12:50:48 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.21 sec.
2024-08-31 12:50:48 03015_aggregator_empty_data_multiple_blocks: [ OK ] 0.23 sec.
2024-08-31 12:50:48 03015_peder1001: [ OK ] 0.26 sec.
2024-08-31 12:50:48 03015_with_fill_invalid_expression: [ OK ] 0.23 sec.
2024-08-31 12:50:48
2024-08-31 12:50:48 Running about 358 stateless tests (ForkPoolWorker-9).
2024-08-31 12:50:48
2024-08-31 12:50:48 03144_alter_column_and_read: [ OK ] 0.36 sec.
2024-08-31 12:50:48 03014_analyzer_groupby_fuzz_60317: [ OK ] 0.23 sec.
2024-08-31 12:50:48 03014_group_by_use_nulls_injective_functions_and_analyzer: [ OK ] 0.23 sec.
2024-08-31 12:50:48 03013_position_const_start_pos: [ OK ] 0.22 sec.
2024-08-31 12:50:48 03014_window_view_crash: [ OK ] 0.26 sec.
2024-08-31 12:50:48 03014_msan_parse_date_time: [ OK ] 0.25 sec.
2024-08-31 12:50:48 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 0.25 sec.
2024-08-31 12:50:48 03013_repeat_with_nonnative_integers: [ OK ] 0.24 sec.
2024-08-31 12:50:48 03011_adaptative_timeout_compatibility: [ OK ] 0.22 sec.
2024-08-31 12:50:48 03010_read_system_parts_table_test: [ OK ] 0.25 sec.
2024-08-31 12:50:48 03010_sum_to_to_count_if_nullable: [ OK ] 0.28 sec.
2024-08-31 12:50:48 03010_view_prewhere_in: [ OK ] 0.24 sec.
2024-08-31 12:50:49 03008_index_small: [ OK ] 0.26 sec.
2024-08-31 12:50:49 03007_column_nullable_uninitialzed_value: [ OK ] 0.23 sec.
2024-08-31 12:50:49 03008_filter_projections_non_deterministoc_functions: [ OK ] 0.51 sec.
2024-08-31 12:50:49 03018_external_with_complex_data_types: [ OK ] 1.56 sec.
2024-08-31 12:50:49 03006_buffer_overflow_join: [ OK ] 0.23 sec.
2024-08-31 12:50:49 03005_input_function_in_join: [ OK ] 0.22 sec.
2024-08-31 12:50:49 03020_long_values_pretty_are_not_cut_if_single: [ OK ] 2.15 sec.
2024-08-31 12:50:49 03003_analyzer_setting: [ OK ] 0.20 sec.
2024-08-31 12:50:50 03006_mv_deduplication_throw_if_async_insert: [ OK ] 0.57 sec.
2024-08-31 12:50:50 03003_enum_and_string_compatible: [ OK ] 0.23 sec.
2024-08-31 12:50:50 03003_compatibility_setting_bad_value: [ OK ] 0.21 sec.
2024-08-31 12:50:50 03009_format_show_database: [ OK ] 1.81 sec.
2024-08-31 12:50:50 03008_uniq_exact_equal_ranges: [ OK ] 1.70 sec.
2024-08-31 12:50:50 03020_output_format_client: [ OK ] 2.97 sec.
2024-08-31 12:50:50 03002_modify_query_cte: [ OK ] 0.27 sec.
2024-08-31 12:50:50 03002_map_array_functions_with_low_cardinality: [ OK ] 0.22 sec.
2024-08-31 12:50:50 03002_int_div_decimal_with_date_bug: [ OK ] 0.23 sec.
2024-08-31 12:50:51 03002_analyzer_prewhere: [ OK ] 0.29 sec.
2024-08-31 12:50:51 03012_parser_backtracking: [ OK ] 2.69 sec.
2024-08-31 12:50:51 02999_analyzer_preimage_null: [ OK ] 0.22 sec.
2024-08-31 12:50:51 03003_prql_panic: [ OK ] 1.52 sec.
2024-08-31 12:50:51 02999_scalar_subqueries_bug_2: [ OK ] 0.22 sec.
2024-08-31 12:50:51 02999_scalar_subqueries_bug_1: [ OK ] 0.25 sec.
2024-08-31 12:50:51 03006_async_insert_deadlock_log: [ OK ] 2.16 sec.
2024-08-31 12:50:51 02999_ulid_short_circuit: [ OK ] 0.24 sec.
2024-08-31 12:50:51 02999_variant_suspicious_types: [ OK ] 0.24 sec.
2024-08-31 12:50:51 03003_database_filesystem_format_detection: [ OK ] 1.76 sec.
2024-08-31 12:50:51 02998_primary_key_skip_columns: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:50:51 02998_analyzer_secret_args_tree_node: [ OK ] 0.23 sec.
2024-08-31 12:50:51 02998_projection_after_attach_partition: [ OK ] 0.27 sec.
2024-08-31 12:50:51 02997_projections_formatting: [ OK ] 0.22 sec.
2024-08-31 12:50:52 02998_to_milliseconds: [ OK ] 0.36 sec.
2024-08-31 12:50:52 02995_preliminary_filters_duplicated_columns: [ OK ] 0.22 sec.
2024-08-31 12:50:52 02995_bad_formatting_union_intersect: [ OK ] 0.25 sec.
2024-08-31 12:50:52 02994_inconsistent_formatting: [ OK ] 0.22 sec.
2024-08-31 12:50:52 02994_sanity_check_settings: [ OK ] 0.33 sec.
2024-08-31 12:50:52 03001_bad_error_message_higher_order_functions: [ OK ] 1.60 sec.
2024-08-31 12:50:52 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 2.28 sec.
2024-08-31 12:50:52 02998_http_redirects: [ OK ] 1.43 sec.
2024-08-31 12:50:52 02992_analyzer_group_by_const: [ OK ] 0.32 sec.
2024-08-31 12:50:53 02991_count_rewrite_analyzer: [ OK ] 0.24 sec.
2024-08-31 12:50:53 02990_arrayFold_nullable_lc: [ OK ] 0.32 sec.
2024-08-31 12:50:53 02992_all_columns_should_have_comment: [ OK ] 0.69 sec.
2024-08-31 12:50:53 02990_optimize_uniq_to_count_alias: [ OK ] 0.25 sec.
2024-08-31 12:50:53 02990_format_not_precedence: [ OK ] 0.21 sec.
2024-08-31 12:50:53 02988_join_using_prewhere_pushdown: [ OK ] 0.24 sec.
2024-08-31 12:50:53 02989_replicated_merge_tree_invalid_metadata_version: [ OK ] 0.33 sec.
2024-08-31 12:50:53 02989_variant_comparison: [ OK ] 0.45 sec.
2024-08-31 12:50:53 02993_lazy_index_loading: [ OK ] 1.44 sec.
2024-08-31 12:50:53 02988_ordinary_database_warning: [ OK ] 0.22 sec.
2024-08-31 12:50:53 02986_leftpad_fixedstring: [ OK ] 0.22 sec.
2024-08-31 12:50:54 02995_forget_partition: [ OK ] 2.25 sec.
2024-08-31 12:50:54 03001_backup_matview_after_modify_query: [ OK ] 3.17 sec.
2024-08-31 12:50:54 02985_minmax_index_aggregate_function: [ OK ] 0.31 sec.
2024-08-31 12:50:54 02985_if_over_big_int_decimal: [ OK ] 0.35 sec.
2024-08-31 12:50:54 02982_parallel_replicas_unexpected_cluster: [ OK ] 0.24 sec.
2024-08-31 12:50:54 02990_format_select_from_explain: [ OK ] 1.43 sec.
2024-08-31 12:50:54 02982_dont_infer_exponent_floats: [ OK ] 0.20 sec.
2024-08-31 12:50:54 02982_unambiguous_alter_commands: [ OK ] 0.25 sec.
2024-08-31 12:50:54 02981_translate_fixedstring: [ OK ] 0.20 sec.
2024-08-31 12:50:54 02983_empty_map: [ OK ] 0.62 sec.
2024-08-31 12:50:54 02981_variant_type_function: [ OK ] 0.31 sec.
2024-08-31 12:50:54 02974_analyzer_array_join_subcolumn: [ OK ] 0.29 sec.
2024-08-31 12:50:54 02975_intdiv_with_decimal: [ OK ] 0.38 sec.
2024-08-31 12:50:55 02974_if_with_map: [ OK ] 0.28 sec.
2024-08-31 12:50:55 02973_block_number_sparse_serialization_and_mutation: [ OK ] 0.41 sec.
2024-08-31 12:50:55 02973_dictionary_table_exception_fix: [ OK ] 0.24 sec.
2024-08-31 12:50:55 02973_analyzer_join_use_nulls_column_not_found: [ OK ] 0.25 sec.
2024-08-31 12:50:55 02982_comments_in_system_tables: [ OK ] 1.66 sec.
2024-08-31 12:50:55 02972_to_string_nullable_timezone: [ OK ] 0.18 sec.
2024-08-31 12:50:56 02981_vertical_merges_memory_usage: [ OK ] 1.66 sec.
2024-08-31 12:50:56 02971_limit_by_distributed: [ OK ] 0.27 sec.
2024-08-31 12:50:56 02974_backup_query_format_null: [ OK ] 2.06 sec.
2024-08-31 12:50:56 02970_visible_width_behavior: [ OK ] 0.25 sec.
2024-08-31 12:50:56 02969_analyzer_eliminate_injective_functions: [ OK ] 0.21 sec.
2024-08-31 12:50:57 02969_functions_to_subcolumns_if_null: [ OK ] 0.26 sec.
2024-08-31 12:50:57 02972_parallel_replicas_cte: [ OK ] 1.60 sec.
2024-08-31 12:50:57 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 2.96 sec.
2024-08-31 12:50:57 02968_analyzer_join_column_not_found: [ OK ] 0.21 sec.
2024-08-31 12:50:58 02968_url_args: [ OK ] 0.25 sec.
2024-08-31 12:50:58 02969_archive_seek: [ OK ] 1.47 sec.
2024-08-31 12:50:58 02967_fuzz_bad_cast: [ OK ] 0.24 sec.
2024-08-31 12:50:58 02967_analyzer_fuzz: [ OK ] 0.25 sec.
2024-08-31 12:50:58 02968_mysql_prefer_column_name_to_alias: [ OK ] 1.29 sec.
2024-08-31 12:50:58 02967_index_hint_crash: [ OK ] 0.21 sec.
2024-08-31 12:50:59 02963_single_value_destructor: [ OK ] 0.32 sec.
2024-08-31 12:50:59 02966_nested_offsets_subcolumn: [ OK ] 0.60 sec.
2024-08-31 12:50:59 02967_parallel_replicas_joins_and_analyzer: [ OK ] 1.07 sec.
2024-08-31 12:50:59 02972_insert_deduplication_token_hierarchical_inserts: [ OK ] 3.80 sec.
2024-08-31 12:50:59 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 3.38 sec.
2024-08-31 12:50:59 02963_test_flexible_disk_configuration: [ OK ] 0.34 sec.
2024-08-31 12:50:59 02962_parallel_window_functions_different_partitioning: [ OK ] 0.23 sec.
2024-08-31 12:50:59 02962_join_using_bug_57894: [ OK ] 0.28 sec.
2024-08-31 12:50:59 02962_analyzer_constant_set: [ OK ] 0.24 sec.
2024-08-31 12:50:59 02962_indexHint_rpn_construction: [ OK ] 0.24 sec.
2024-08-31 12:50:59 02961_analyzer_low_cardinality_fuzzer: [ OK ] 0.24 sec.
2024-08-31 12:50:59 02987_group_array_intersect: [ OK ] 6.03 sec.
2024-08-31 12:50:59 02960_alter_table_part_query_parameter: [ OK ] 0.23 sec.
2024-08-31 12:50:59 02959_system_database_engines: [ OK ] 0.21 sec.
2024-08-31 12:51:00 02956_fix_to_start_of_milli_microsecond: [ OK ] 0.23 sec.
2024-08-31 12:51:00 02953_slow_create_view: [ OK ] 0.30 sec.
2024-08-31 12:51:00 02954_analyzer_fuzz_i57086: [ OK ] 0.32 sec.
2024-08-31 12:51:00 02952_archive_parsing: [ OK ] 0.20 sec.
2024-08-31 12:51:00 02955_analyzer_using_functional_args: [ OK ] 0.68 sec.
2024-08-31 12:51:00 02950_reading_array_tuple_subcolumns: [ OK ] 0.50 sec.
2024-08-31 12:51:00 02950_part_log_bytes_uncompressed: [ OK ] 0.47 sec.
2024-08-31 12:51:00 02950_parallel_replicas_used_count: [ OK ] 0.39 sec.
2024-08-31 12:51:00 02949_parallel_replicas_scalar_subquery_big_integer: [ OK ] 0.23 sec.
2024-08-31 12:51:01 02949_parallel_replicas_in_subquery: [ OK ] 0.37 sec.
2024-08-31 12:51:01 02949_ttl_group_by_bug: [ OK ] 0.25 sec.
2024-08-31 12:51:01 02947_dropped_tables_parts: [ OK ] 0.25 sec.
2024-08-31 12:51:01 02956_clickhouse_local_system_parts: [ OK ] 1.58 sec.
2024-08-31 12:51:01 02946_literal_alias_misclassification: [ OK ] 0.22 sec.
2024-08-31 12:51:01 02943_tokenbf_and_ngrambf_indexes_support_match_function: [ OK ] 0.36 sec.
2024-08-31 12:51:01 02943_variant_element: [ OK ] 0.24 sec.
2024-08-31 12:51:01 02943_order_by_all: [ OK ] 0.41 sec.
2024-08-31 12:51:01 02952_clickhouse_local_query_parameters_cli: [ OK ] 1.50 sec.
2024-08-31 12:51:01 02940_json_array_of_unnamed_tuples_inference: [ OK ] 0.20 sec.
2024-08-31 12:51:02 02941_projections_external_aggregation: [ OK ] 0.63 sec.
2024-08-31 12:51:02 02935_format_with_arbitrary_types: [ OK ] 0.38 sec.
2024-08-31 12:51:02 02935_ipv6_bit_operations: [ OK ] 0.22 sec.
2024-08-31 12:51:02 02994_merge_tree_mutations_cleanup: [ OK ] 10.33 sec.
2024-08-31 12:51:05 02933_replicated_database_forbid_create_as_select: [ OK ] 2.74 sec.
2024-08-31 12:51:05 02933_ephemeral_mv: [ OK ] 0.36 sec.
2024-08-31 12:51:05 02933_sqid: [ OK ] 0.39 sec.
2024-08-31 12:51:06 02933_group_by_memory_usage: [ OK ] 3.67 sec.
2024-08-31 12:51:06 02933_compare_with_bool_as_string: [ OK ] 0.21 sec.
2024-08-31 12:51:07 02969_auto_format_detection: [ OK ] 10.05 sec.
2024-08-31 12:51:07 02963_remote_read_small_buffer_size_bug: [ OK ] 8.27 sec.
2024-08-31 12:51:07 02932_query_settings_max_size_drop: [ OK ] 0.37 sec.
2024-08-31 12:51:07 02932_punycode: [ OK ] 0.69 sec.
2024-08-31 12:51:08 02932_group_by_null_fuzzer: [ OK ] 0.26 sec.
2024-08-31 12:51:08 02932_parallel_replicas_fuzzer: [ OK ] 0.41 sec.
2024-08-31 12:51:08 02935_http_content_type_with_http_headers_progress: [ OK ] 6.48 sec.
2024-08-31 12:51:08 02932_idna: [ OK ] 0.70 sec.
2024-08-31 12:51:09 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.27 sec.
2024-08-31 12:51:09 02931_ubsan_error_arena_aligned_alloc: [ OK ] 0.20 sec.
2024-08-31 12:51:09 02923_join_use_nulls_modulo: [ OK ] 0.22 sec.
2024-08-31 12:51:09 02941_variant_type_2: [ OK ] 8.54 sec.
2024-08-31 12:51:09 02932_kill_query_sleep: [ OK ] 3.75 sec.
2024-08-31 12:51:09 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 1.52 sec.
2024-08-31 12:51:09 02923_cte_equality_disjunction: [ OK ] 0.24 sec.
2024-08-31 12:51:10 02922_respect_nulls_parser: [ OK ] 0.43 sec.
2024-08-31 12:51:10 02922_respect_nulls_Nullable: [ OK ] 0.44 sec.
2024-08-31 12:51:10 02922_respect_nulls_extensive: [ OK ] 0.54 sec.
2024-08-31 12:51:10 02931_file_cluster: [ OK ] 1.73 sec.
2024-08-31 12:51:10 02921_bit_hamming_distance_big_int: [ OK ] 0.24 sec.
2024-08-31 12:51:10 02921_fuzzbits_with_array_join: [ OK ] 0.22 sec.
2024-08-31 12:51:10 02920_rename_column_of_skip_indices: [ OK ] 0.26 sec.
2024-08-31 12:51:10 02920_alter_column_of_projections: [ OK ] 0.34 sec.
2024-08-31 12:51:11 02918_analyzer_to_ast_crash: [ OK ] 0.22 sec.
2024-08-31 12:51:11 02922_server_exit_code: [ OK ] 1.52 sec.
2024-08-31 12:51:11 02918_parallel_replicas_custom_key_unavailable_replica: [ OK ] 0.26 sec.
2024-08-31 12:51:11 02918_join_pm_lc_crash: [ OK ] 0.25 sec.
2024-08-31 12:51:11 02941_variant_type_4: [ OK ] 10.40 sec.
2024-08-31 12:51:12 02918_template_format_deadlock: [ OK ] 1.56 sec.
2024-08-31 12:51:12 02918_optimize_count_for_merge_tables: [ OK ] 0.26 sec.
2024-08-31 12:51:12 02916_csv_infer_numbers_from_strings: [ OK ] 0.21 sec.
2024-08-31 12:51:12 02916_distributed_skip_unavailable_shards: [ OK ] 0.24 sec.
2024-08-31 12:51:12 02921_file_engine_size_virtual_column: [ OK ] 2.26 sec.
2024-08-31 12:51:12 02916_set_formatting: [ OK ] 0.22 sec.
2024-08-31 12:51:13 02918_multif_for_nullable: [ OK ] 2.28 sec.
2024-08-31 12:51:13 02941_variant_type_1: [ OK ] 11.58 sec.
2024-08-31 12:51:13 02915_sleep_large_uint: [ OK ] 0.28 sec.
2024-08-31 12:51:13 02918_gorilla_invalid_file: [ OK ] 1.37 sec.
2024-08-31 12:51:13 02915_analyzer_fuzz_2: [ OK ] 0.23 sec.
2024-08-31 12:51:13 02915_analyzer_fuzz_5: [ OK ] 0.22 sec.
2024-08-31 12:51:13 02915_analyzer_fuzz_6: [ OK ] 0.28 sec.
2024-08-31 12:51:13 02912_group_array_sample: [ OK ] 0.22 sec.
2024-08-31 12:51:14 02911_analyzer_explain_estimate: [ OK ] 0.22 sec.
2024-08-31 12:51:14 02911_cte_invalid_query_analysis: [ OK ] 0.28 sec.
2024-08-31 12:51:14 02915_input_table_function_in_subquery: [ OK ] 1.70 sec.
2024-08-31 12:51:14 02915_fpc_overflow: [ OK ] 1.36 sec.
2024-08-31 12:51:14 02911_add_index_and_materialize_index: [ OK ] 0.22 sec.
2024-08-31 12:51:14 02910_nullable_enum_cast: [ OK ] 0.21 sec.
2024-08-31 12:51:14 02911_system_symbols: [ OK ] 0.37 sec.
2024-08-31 12:51:14 02910_bad_logs_level_in_local: [ OK ] 0.36 sec.
2024-08-31 12:51:14 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 3.80 sec.
2024-08-31 12:51:15 02910_object-json-crash-add-column: [ OK ] 0.33 sec.
2024-08-31 12:51:15 02908_filesystem_cache_as_collection: [ OK ] 0.24 sec.
2024-08-31 12:51:15 02911_arrow_large_list: [ OK ] 1.51 sec.
2024-08-31 12:51:15 02910_replicated_merge_parameters_must_consistent: [ OK ] 0.45 sec.
2024-08-31 12:51:15 02907_read_buffer_content_is_cached_multiple_blobs: [ OK ] 0.42 sec.
2024-08-31 12:51:15 02907_fromDaysSinceYearZero: [ OK ] 0.40 sec.
2024-08-31 12:51:16 02908_table_ttl_dependency: [ OK ] 1.94 sec.
2024-08-31 12:51:16 02915_lazy_loading_of_base_backups: [ OK ] 3.85 sec.
2024-08-31 12:51:17 02906_flatten_only_true_nested: [ OK ] 0.22 sec.
2024-08-31 12:51:17 02907_clickhouse_dictionary_bug: [ OK ] 1.54 sec.
2024-08-31 12:51:17 02903_bug_43644: [ OK ] 0.24 sec.
2024-08-31 12:51:17 02902_add_scalar_in_all_case: [ OK ] 0.24 sec.
2024-08-31 12:51:17 02908_Npy_files_caching: [ OK ] 2.75 sec.
2024-08-31 12:51:17 02902_select_subcolumns_from_engine_null: [ OK ] 0.23 sec.
2024-08-31 12:51:18 02902_topKGeneric_deserialization_memory: [ OK ] 0.24 sec.
2024-08-31 12:51:18 02901_remove_nullable_crash_analyzer: [ OK ] 0.26 sec.
2024-08-31 12:51:18 02901_analyzer_recursive_window: [ OK ] 0.24 sec.
2024-08-31 12:51:18 02907_backup_restore_flatten_nested: [ OK ] 3.31 sec.
2024-08-31 12:51:18 02900_window_function_with_sparse_column: [ OK ] 0.24 sec.
2024-08-31 12:51:18 02900_issue_55858: [ OK ] 0.34 sec.
2024-08-31 12:51:19 02904_empty_order_by_with_setting_enabled: [ OK ] 2.14 sec.
2024-08-31 12:51:19 02903_client_insert_in_background: [ OK ] 2.06 sec.
2024-08-31 12:51:19 02899_distributed_limit_by: [ OK ] 0.50 sec.
2024-08-31 12:51:19 02900_clickhouse_local_drop_current_database: [ OK ] 1.53 sec.
2024-08-31 12:51:19 02898_parallel_replicas_custom_key_final: [ OK ] 0.25 sec.
2024-08-31 12:51:19 02899_indexing_by_space_filling_curves: [ OK ] 0.51 sec.
2024-08-31 12:51:20 02897_alter_partition_parameters: [ OK ] 0.54 sec.
2024-08-31 12:51:20 02896_optimize_array_exists_to_has_with_date: [ OK ] 0.21 sec.
2024-08-31 12:51:20 02900_matview_create_to_errors: [ OK ] 1.51 sec.
2024-08-31 12:51:20 02907_preferred_optimize_projection_name: [ OK ] 4.73 sec.
2024-08-31 12:51:20 02896_cyclic_aliases_crash: [ OK ] 0.28 sec.
2024-08-31 12:51:20 02896_leading_zeroes_no_octal: [ OK ] 0.87 sec.
2024-08-31 12:51:21 02893_bad_sample_view: [ OK ] 0.21 sec.
2024-08-31 12:51:21 02891_alter_update_adaptive_granularity: [ OK ] 0.24 sec.
2024-08-31 12:51:21 02891_rename_table_without_keyword: [ OK ] 0.28 sec.
2024-08-31 12:51:21 02891_functions_over_sparse_columns: [ OK ] 0.24 sec.
2024-08-31 12:51:21 02895_peak_memory_usage_http_headers_regression: [ OK ] 1.50 sec.
2024-08-31 12:51:22 02890_untuple_column_names: [ OK ] 0.30 sec.
2024-08-31 12:51:22 02890_partition_prune_in_extra_columns: [ OK ] 0.23 sec.
2024-08-31 12:51:22 02894_ast_depth_check: [ OK ] 1.55 sec.
2024-08-31 12:51:22 02889_print_pretty_type_names: [ OK ] 0.20 sec.
2024-08-31 12:51:22 02890_describe_table_options: [ OK ] 0.24 sec.
2024-08-31 12:51:22 02916_replication_protocol_wait_for_part: [ OK ] 10.35 sec.
2024-08-31 12:51:22 02888_obsolete_settings: [ OK ] 0.22 sec.
2024-08-31 12:51:22 02887_tuple_element_distributed: [ OK ] 0.24 sec.
2024-08-31 12:51:22 02887_format_readable_timedelta_subseconds: [ OK ] 0.25 sec.
2024-08-31 12:51:22 02886_binary_like: [ OK ] 0.27 sec.
2024-08-31 12:51:22 02886_missed_json_subcolumns: [ OK ] 0.29 sec.
2024-08-31 12:51:22 02885_create_distributed_table_without_as: [ OK ] 0.23 sec.
2024-08-31 12:51:22 02884_duplicate_index_name: [ OK ] 0.19 sec.
2024-08-31 12:51:23 02884_string_distance_function: [ OK ] 0.40 sec.
2024-08-31 12:51:23 02883_array_scalar_mult_div_modulo: [ OK ] 0.30 sec.
2024-08-31 12:51:23 02883_read_in_reverse_order_virtual_column: [ OK ] 0.57 sec.
2024-08-31 12:51:23 02882_primary_key_index_in_function_different_types: [ OK ] 0.26 sec.
2024-08-31 12:51:23 02882_formatQuery: [ OK ] 0.34 sec.
2024-08-31 12:51:23 02881_system_detached_parts_modification_time: [ OK ] 0.25 sec.
2024-08-31 12:51:24 02880_indexHint__partition_id: [ OK ] 0.22 sec.
2024-08-31 12:51:24 02884_parquet_new_encodings: [ OK ] 1.51 sec.
2024-08-31 12:51:25 02896_max_execution_time_with_break_overflow_mode: [ OK ] 5.25 sec.
2024-08-31 12:51:25 02876_yyyymmddtodate: [ OK ] 1.00 sec.
2024-08-31 12:51:25 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 0.54 sec.
2024-08-31 12:51:26 02876_json_incomplete_types_as_strings_inference: [ OK ] 0.50 sec.
2024-08-31 12:51:26 02876_yyyymmddhhmmsstodatetime: [ OK ] 1.43 sec.
2024-08-31 12:51:27 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 3.72 sec.
2024-08-31 12:51:28 02875_json_array_as_string: [ OK ] 0.40 sec.
2024-08-31 12:51:28 02875_parallel_replicas_cluster_all_replicas: [ OK ] 1.16 sec.
2024-08-31 12:51:28 02900_buffer_table_alter_race: [ OK ] 9.73 sec.
2024-08-31 12:51:28 02875_final_invalid_read_ranges_bug: [ OK ] 0.64 sec.
2024-08-31 12:51:29 02875_parallel_replicas_remote: [ OK ] 0.97 sec.
2024-08-31 12:51:29 02875_fix_column_decimal_serialization: [ OK ] 0.65 sec.
2024-08-31 12:51:30 02877_optimize_read_in_order_from_view: [ OK ] 5.91 sec.
2024-08-31 12:51:30 02874_parquet_multiple_batches_array_inconsistent_offsets: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:51:30 02874_toDaysSinceYearZero: [ OK ] 0.70 sec.
2024-08-31 12:51:30 02874_parse_json_as_json_each_row_on_no_metadata: [ OK ] 0.46 sec.
2024-08-31 12:51:30 02874_analysis_of_variance_overflow: [ OK ] 0.47 sec.
2024-08-31 12:51:30 02874_json_merge_patch_function_test: [ OK ] 0.77 sec.
2024-08-31 12:51:31 02872_prewhere_filter: [ OK ] 0.42 sec.
2024-08-31 12:51:31 02875_merge_engine_set_index: [ OK ] 5.38 sec.
2024-08-31 12:51:33 02875_show_functions: [ OK ] 4.87 sec.
2024-08-31 12:51:33 02871_multiple_joins_rewriter_v2_handle_last_table_columns: [ OK ] 0.61 sec.
2024-08-31 12:51:34 02871_join_on_system_errors: [ OK ] 0.49 sec.
2024-08-31 12:51:35 02870_per_column_settings: [ OK ] 0.93 sec.
2024-08-31 12:51:35 02932_refreshable_materialized_views: [ OK ] 29.39 sec.
2024-08-31 12:51:36 02869_unicode_minus: [ OK ] 0.55 sec.
2024-08-31 12:51:36 02871_clickhouse_client_restart_pager: [ OK ] 4.36 sec.
2024-08-31 12:51:36 02868_select_support_from_keywords: [ OK ] 0.36 sec.
2024-08-31 12:51:37 02868_operator_is_not_distinct_from_priority: [ OK ] 0.62 sec.
2024-08-31 12:51:37 02867_null_lc_in_bug: [ OK ] 0.62 sec.
2024-08-31 12:51:37 02864_statistic_operate: [ OK ] 0.72 sec.
2024-08-31 12:51:37 02864_profile_event_part_lock: [ OK ] 0.52 sec.
2024-08-31 12:51:38 02883_zookeeper_finalize_stress: [ OK ] 15.46 sec.
2024-08-31 12:51:38 02869_http_headers_elapsed_ns: [ OK ] 3.20 sec.
2024-08-31 12:51:38 02864_statistic_exception: [ OK ] 0.43 sec.
2024-08-31 12:51:39 02863_ignore_foreign_keys_in_tables_definition: [ OK ] 0.26 sec.
2024-08-31 12:51:39 02864_filtered_url_with_globs: [ OK ] 1.37 sec.
2024-08-31 12:51:39 02863_mutation_where_in_set_result_cache_pipeline_stuck_bug: [ OK ] 0.30 sec.
2024-08-31 12:51:39 02862_sorted_distinct_sparse_fix: [ OK ] 0.27 sec.
2024-08-31 12:51:39 02861_filter_pushdown_const_bug: [ OK ] 0.27 sec.
2024-08-31 12:51:39 02861_interpolate_alias_precedence: [ OK ] 0.25 sec.
2024-08-31 12:51:39 02860_distributed_flush_on_detach: [ OK ] 0.25 sec.
2024-08-31 12:51:39 02873_s3_presigned_url_and_url_with_special_characters: [ OK ] 9.13 sec.
2024-08-31 12:51:39 02861_join_on_nullsafe_compare: [ OK ] 0.65 sec.
2024-08-31 12:51:40 02895_npy_format: [ OK ] 19.59 sec.
2024-08-31 12:51:40 02845_domain_rfc_support_ipv6: [ OK ] 0.29 sec.
2024-08-31 12:51:40 02845_arrayShiftRotate: [ OK ] 0.41 sec.
2024-08-31 12:51:40 02864_restore_table_with_broken_part: [ OK ] 3.05 sec.
2024-08-31 12:51:41 02845_threads_count_in_distributed_queries: [ OK ] 1.47 sec.
2024-08-31 12:51:41 02843_date_predicate_optimizations_bugs: [ OK ] 0.23 sec.
2024-08-31 12:51:41 02843_context_has_expired: [ OK ] 0.34 sec.
2024-08-31 12:51:41 02872_null_as_default_nested: [ OK ] 10.15 sec.
2024-08-31 12:51:41 02842_filesystem_cache_validate_path: [ OK ] 0.23 sec.
2024-08-31 12:51:42 02844_table_function_url_filter_by_virtual_columns: [ OK ] 1.75 sec.
2024-08-31 12:51:42 02845_parquet_odd_decimals: [ OK ] 2.17 sec.
2024-08-31 12:51:42 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 0.33 sec.
2024-08-31 12:51:42 02842_vertical_merge_after_add_drop_column: [ OK ] 0.27 sec.
2024-08-31 12:51:42 02842_mutations_replace_non_deterministic: [ OK ] 0.72 sec.
2024-08-31 12:51:43 02845_table_function_hdfs_filter_by_virtual_columns: [ OK ] 3.08 sec.
2024-08-31 12:51:43 02841_group_array_sorted: [ OK ] 0.53 sec.
2024-08-31 12:51:43 02841_tuple_modulo: [ OK ] 0.23 sec.
2024-08-31 12:51:43 02842_table_function_file_filter_by_virtual_columns: [ OK ] 1.75 sec.
2024-08-31 12:51:44 02842_suggest_http_page_in_error_message: [ OK ] 1.39 sec.
2024-08-31 12:51:44 02841_join_filter_set_sparse: [ OK ] 0.38 sec.
2024-08-31 12:51:44 02842_one_input_format: [ OK ] 3.32 sec.
2024-08-31 12:51:44 02840_merge__table_or_filter: [ OK ] 0.36 sec.
2024-08-31 12:51:45 02840_grace_hash_join_structure_mismatch: [ OK ] 0.24 sec.
2024-08-31 12:51:45 02835_join_step_explain: [ OK ] 0.25 sec.
2024-08-31 12:51:45 02835_fuzz_remove_redundant_sorting: [ OK ] 0.34 sec.
2024-08-31 12:51:45 02841_parallel_final_wrong_columns_order: [ OK ] 1.70 sec.
2024-08-31 12:51:45 02834_timestamp_function: [ OK ] 0.29 sec.
2024-08-31 12:51:45 02834_array_exists_segfault: [ OK ] 0.26 sec.
2024-08-31 12:51:45 02834_formats_with_variable_number_of_columns: [ OK ] 0.28 sec.
2024-08-31 12:51:45 02841_parallel_replicas_summary: [ OK ] 2.26 sec.
2024-08-31 12:51:45 02833_tuple_concat: [ OK ] 0.32 sec.
2024-08-31 12:51:45 02874_array_random_sample: [ OK ] 15.62 sec.
2024-08-31 12:51:45 02841_not_ready_set_bug: [ OK ] 2.39 sec.
2024-08-31 12:51:45 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 4.73 sec.
2024-08-31 12:51:45 02833_sparse_columns_tuple_function: [ OK ] 0.25 sec.
2024-08-31 12:51:46 02832_transform_fixed_string_no_default: [ OK ] 0.22 sec.
2024-08-31 12:51:46 02833_std_alias: [ OK ] 0.24 sec.
2024-08-31 12:51:46 02831_trash: [ OK ] 0.22 sec.
2024-08-31 12:51:46 02816_check_projection_metadata: [ OK ] 0.21 sec.
2024-08-31 12:51:46 02815_first_line: [ OK ] 0.20 sec.
2024-08-31 12:51:46 02815_logical_error_cannot_get_column_name_of_set: [ OK ] 0.24 sec.
2024-08-31 12:51:46 02815_range_dict_no_direct_join: [ OK ] 0.28 sec.
2024-08-31 12:51:46 02815_join_algorithm_setting: [ OK ] 0.81 sec.
2024-08-31 12:51:47 02815_alias_to_length: [ OK ] 0.22 sec.
2024-08-31 12:51:47 02815_fix_not_found_constants_col_in_block: [ OK ] 0.24 sec.
2024-08-31 12:51:47 02833_local_udf_options: [ OK ] 1.52 sec.
2024-08-31 12:51:47 02833_local_with_dialect: [ OK ] 1.53 sec.
2024-08-31 12:51:47 02814_ReplacingMergeTree_fix_select_final_on_single_partition: [ OK ] 0.27 sec.
2024-08-31 12:51:47 02814_create_index_uniq_noop: [ OK ] 0.18 sec.
2024-08-31 12:51:47 02833_url_without_path_encoding: [ OK ] 1.72 sec.
2024-08-31 12:51:47 02813_any_value: [ OK ] 0.24 sec.
2024-08-31 12:51:47 02813_array_agg: [ OK ] 0.24 sec.
2024-08-31 12:51:47 02813_func_now_and_alias: [ OK ] 0.25 sec.
2024-08-31 12:51:47 02813_float_parsing: [ OK ] 0.21 sec.
2024-08-31 12:51:47 02813_seriesDecomposeSTL: [ OK ] 0.42 sec.
2024-08-31 12:51:47 02813_func_today_and_alias: [ OK ] 0.21 sec.
2024-08-31 12:51:47 02813_series_period_detect: [ OK ] 0.38 sec.
2024-08-31 12:51:47 02813_seriesOutliersDetectTukey: [ OK ] 0.43 sec.
2024-08-31 12:51:47 02812_subquery_operators: [ OK ] 0.26 sec.
2024-08-31 12:51:48 02811_parallel_replicas_prewhere_count: [ OK ] 0.24 sec.
2024-08-31 12:51:48 02811_insert_schema_inference: [ OK ] 0.23 sec.
2024-08-31 12:51:48 02812_pointwise_array_operations: [ OK ] 0.37 sec.
2024-08-31 12:51:48 02811_primary_key_in_columns: [ OK ] 0.36 sec.
2024-08-31 12:51:48 02811_invalid_embedded_rocksdb_create: [ OK ] 0.22 sec.
2024-08-31 12:51:48 02810_fix_remove_dedundant_distinct_view: [ OK ] 0.25 sec.
2024-08-31 12:51:48 02810_row_binary_with_defaults: [ OK ] 0.21 sec.
2024-08-31 12:51:48 02809_has_subsequence: [ OK ] 0.31 sec.
2024-08-31 12:51:48 02809_has_token: [ OK ] 0.21 sec.
2024-08-31 12:51:48 02809_prewhere_and_in: [ OK ] 0.36 sec.
2024-08-31 12:51:48 02807_lower_utf8_msan: [ OK ] 0.21 sec.
2024-08-31 12:51:48 02806_cte_block_cannot_be_empty: [ OK ] 0.24 sec.
2024-08-31 12:51:49 02815_no_throw_in_simple_queries: [ OK ] 3.11 sec.
2024-08-31 12:51:49 02800_transform_alter: [ OK ] 0.28 sec.
2024-08-31 12:51:50 02811_csv_input_field_type_mismatch: [ OK ] 2.32 sec.
2024-08-31 12:51:50 02798_generic_transform: [ OK ] 0.24 sec.
2024-08-31 12:51:50 02798_explain_settings_not_applied_bug: [ OK ] 0.21 sec.
2024-08-31 12:51:50 02803_backup_tmp_files: [ OK ] 2.11 sec.
2024-08-31 12:51:51 02797_range_nullable: [ OK ] 0.30 sec.
2024-08-31 12:51:51 02800_clickhouse_local_default_settings: [ OK ] 1.50 sec.
2024-08-31 12:51:51 02792_drop_projection_lwd: [ OK ] 0.31 sec.
2024-08-31 12:51:51 02791_final_block_structure_mismatch_bug: [ OK ] 0.37 sec.
2024-08-31 12:51:51 02792_alter_table_modify_comment: [ OK ] 0.49 sec.
2024-08-31 12:51:52 02802_clickhouse_disks_s3_copy: [ OK ] 3.44 sec.
2024-08-31 12:51:52 02790_url_multiple_tsv_files: [ OK ] 0.51 sec.
2024-08-31 12:51:52 02793_implicit_pretty_format_settings: [ OK ] 1.51 sec.
2024-08-31 12:51:52 02790_fix_coredump_when_compile_expression: [ OK ] 0.20 sec.
2024-08-31 12:51:52 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 0.25 sec.
2024-08-31 12:51:52 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 0.25 sec.
2024-08-31 12:51:52 02789_jit_cannot_convert_column: [ OK ] 0.19 sec.
2024-08-31 12:51:53 02801_backup_native_copy: [ OK ] 4.18 sec.
2024-08-31 12:51:53 02788_current_schemas_function: [ OK ] 0.24 sec.
2024-08-31 12:51:53 02787_transform_null: [ OK ] 0.24 sec.
2024-08-31 12:51:53 02785_left_anti_join_bug: [ OK ] 0.25 sec.
2024-08-31 12:51:53 02790_client_max_opening_fd: [ OK ] 1.54 sec.
2024-08-31 12:51:53 02785_global_join_too_many_columns: [ OK ] 0.26 sec.
2024-08-31 12:51:54 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 0.24 sec.
2024-08-31 12:51:54 02784_projections_read_in_order_bug: [ OK ] 0.25 sec.
2024-08-31 12:51:54 02784_schema_inference_null_as_default: [ OK ] 0.22 sec.
2024-08-31 12:51:54 02786_parquet_big_integer_compatibility: [ OK ] 1.55 sec.
2024-08-31 12:51:54 02783_parsedatetimebesteffort_syslog: [ OK ] 0.23 sec.
2024-08-31 12:51:56 02789_reading_from_s3_with_connection_pool: [ OK ] 3.60 sec.
2024-08-31 12:51:56 02784_disable_async_with_dedup_correctly: [ OK ] 2.74 sec.
2024-08-31 12:51:57 02790_async_queries_in_query_log: [ OK ] 5.51 sec.
2024-08-31 12:51:57 02783_date_predicate_optimizations: [ OK ] 1.02 sec.
2024-08-31 12:51:57 02782_values_null_to_lc_nullable: [ OK ] 0.20 sec.
2024-08-31 12:51:57 02771_jit_functions_comparison_crash: [ OK ] 0.25 sec.
2024-08-31 12:51:57 02771_if_constant_folding: [ OK ] 0.20 sec.
2024-08-31 12:51:58 02783_parallel_replicas_trivial_count_optimization: [ OK ] 3.28 sec.
2024-08-31 12:51:58 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 0.26 sec.
2024-08-31 12:51:58 02782_avro_decimals: [ OK ] 1.69 sec.
2024-08-31 12:51:58 02771_ignore_data_skipping_indices: [ OK ] 0.32 sec.
2024-08-31 12:51:58 02769_compare_functions_nan: [ OK ] 0.32 sec.
2024-08-31 12:51:58 02770_jit_aggregation_nullable_key_fix: [ OK ] 0.51 sec.
2024-08-31 12:51:58 02766_bitshift_with_const_arguments: [ OK ] 0.27 sec.
2024-08-31 12:51:59 02764_parallel_replicas_plain_merge_tree: [ OK ] 0.27 sec.
2024-08-31 12:51:59 02764_index_analysis_fix: [ OK ] 0.23 sec.
2024-08-31 12:51:59 02763_row_policy_storage_merge_alias: [ OK ] 0.33 sec.
2024-08-31 12:51:59 02752_space_function: [ OK ] 0.35 sec.
2024-08-31 12:52:00 02766_prql: [ OK ] 1.78 sec.
2024-08-31 12:52:00 02810_async_insert_dedup_replicated_collapsing: [ OK ] 12.32 sec.
2024-08-31 12:52:00 02751_query_log_test_partitions: [ OK ] 0.50 sec.
2024-08-31 12:52:00 02817_structure_to_schema: [ OK ] 14.65 sec.
2024-08-31 12:52:00 02751_multiif_to_if_crash: [ OK ] 0.25 sec.
2024-08-31 12:52:00 02784_parallel_replicas_automatic_decision: [ OK ] 6.34 sec.
2024-08-31 12:52:00 02771_skip_empty_files: [ OK ] 3.41 sec.
2024-08-31 12:52:01 02746_index_analysis_binary_operator_with_null: [ OK ] 0.24 sec.
2024-08-31 12:52:01 02737_sql_auto_is_null: [ OK ] 0.22 sec.
2024-08-31 12:52:01 02737_arrayJaccardIndex: [ OK ] 0.37 sec.
2024-08-31 12:52:01 02735_array_map_array_of_tuples: [ OK ] 0.24 sec.
2024-08-31 12:52:01 02735_system_zookeeper_connection: [ OK ] 0.25 sec.
2024-08-31 12:52:01 02734_sparse_columns_short_circuit: [ OK ] 0.27 sec.
2024-08-31 12:52:01 02734_optimize_group_by: [ OK ] 0.22 sec.
2024-08-31 12:52:01 02734_big_int_from_float_ubsan: [ OK ] 0.22 sec.
2024-08-31 12:52:02 02741_hashed_dictionary_load_factor: [ OK ] 1.14 sec.
2024-08-31 12:52:02 02734_sparse_columns_mutation: [ OK ] 0.35 sec.
2024-08-31 12:52:02 02751_protobuf_ipv6: [ OK ] 1.82 sec.
2024-08-31 12:52:02 02733_sparse_columns_reload: [ OK ] 0.26 sec.
2024-08-31 12:52:02 02731_nothing_deserialization: [ OK ] 0.20 sec.
2024-08-31 12:52:02 02730_with_fill_by_sorting_prefix: [ OK ] 0.41 sec.
2024-08-31 12:52:02 02731_parallel_replicas_join_subquery: [ OK ] 0.79 sec.
2024-08-31 12:52:03 02725_object_column_alter: [ OK ] 0.25 sec.
2024-08-31 12:52:03 02725_alias_columns_should_not_allow_compression_codec: [ OK ] 0.26 sec.
2024-08-31 12:52:03 02725_cnf_large_check: [ OK ] 0.28 sec.
2024-08-31 12:52:03 02751_text_formats_bad_nullable_parsing: [ OK ] 2.91 sec.
2024-08-31 12:52:03 02725_any_join_single_row: [ OK ] 0.31 sec.
2024-08-31 12:52:03 02724_function_in_left_table_clause_asof_join: [ OK ] 0.22 sec.
2024-08-31 12:52:03 02731_replace_partition_from_temporary_table: [ OK ] 1.50 sec.
2024-08-31 12:52:03 02724_persist_interval_type: [ OK ] 0.27 sec.
2024-08-31 12:52:03 02724_mutliple_storage_join: [ OK ] 0.24 sec.
2024-08-31 12:52:04 02723_jit_aggregation_bug_48120: [ OK ] 0.28 sec.
2024-08-31 12:52:04 02722_matcher_join_use_nulls: [ OK ] 0.52 sec.
2024-08-31 12:52:04 02721_url_cluster: [ OK ] 0.52 sec.
2024-08-31 12:52:04 02720_row_policy_column_with_dots: [ OK ] 0.27 sec.
2024-08-31 12:52:05 02751_multiquery_with_argument: [ OK ] 4.63 sec.
2024-08-31 12:52:05 02723_param_exception_message_context: [ OK ] 1.59 sec.
2024-08-31 12:52:05 02716_int256_arrayfunc: [ OK ] 0.24 sec.
2024-08-31 12:52:05 02715_or_null: [ OK ] 0.22 sec.
2024-08-31 12:52:05 02732_rename_after_processing: [ OK ] 3.43 sec.
2024-08-31 12:52:05 02714_date_date32_in: [ OK ] 0.21 sec.
2024-08-31 12:52:05 02713_array_low_cardinality_string: [ OK ] 0.24 sec.
2024-08-31 12:52:05 02721_parquet_field_not_found: [ OK ] 1.66 sec.
2024-08-31 12:52:05 02713_ip4_uint_compare: [ OK ] 0.22 sec.
2024-08-31 12:52:05 02711_trim_aliases: [ OK ] 0.20 sec.
2024-08-31 12:52:06 02713_sequence_match_serialization_fix: [ OK ] 0.26 sec.
2024-08-31 12:52:06 02844_max_backup_bandwidth_s3: [ OK ] 26.11 sec.
2024-08-31 12:52:06 02711_server_uuid_macro: [ OK ] 0.34 sec.
2024-08-31 12:52:06 02708_dotProduct: [ OK ] 0.45 sec.
2024-08-31 12:52:06 02707_analyzer_nested_lambdas_types: [ OK ] 0.23 sec.
2024-08-31 12:52:06 02706_kolmogorov_smirnov_test: [ OK ] 0.33 sec.
2024-08-31 12:52:06 02705_projection_and_ast_optimizations_bug: [ OK ] 0.22 sec.
2024-08-31 12:52:06 02705_grouping_keys_equal_keys: [ OK ] 0.24 sec.
2024-08-31 12:52:06 02703_jit_external_aggregation: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:52:06 02705_settings_check_changed_flag: [ OK ] 0.35 sec.
2024-08-31 12:52:07 02718_parquet_metadata_format: [ OK ] 2.65 sec.
2024-08-31 12:52:07 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.21 sec.
2024-08-31 12:52:07 02699_polygons_sym_difference_rollup: [ OK ] 0.23 sec.
2024-08-31 12:52:07 02699_polygons_sym_difference_total: [ OK ] 0.25 sec.
2024-08-31 12:52:07 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 0.26 sec.
2024-08-31 12:52:07 02718_cli_dashed_options_parsing: [ OK ] 3.10 sec.
2024-08-31 12:52:07 02710_protobuf_ipv4_date32: [ OK ] 2.00 sec.
2024-08-31 12:52:07 02693_multiple_joins_in: [ OK ] 0.23 sec.
2024-08-31 12:52:08 02695_logical_optimizer_alias_bug: [ OK ] 0.28 sec.
2024-08-31 12:52:08 02692_multiple_joins_unicode: [ OK ] 0.27 sec.
2024-08-31 12:52:08 02691_multiple_joins_backtick_identifiers: [ OK ] 0.27 sec.
2024-08-31 12:52:08 02714_async_inserts_empty_data: [ OK ] 2.94 sec.
2024-08-31 12:52:08 02688_aggregate_states: [ OK ] 0.37 sec.
2024-08-31 12:52:08 02688_long_aggregate_function_names: [ OK ] 0.26 sec.
2024-08-31 12:52:08 02687_native_fuzz: [ OK ] 0.23 sec.
2024-08-31 12:52:08 02686_bson3: [ OK ] 0.21 sec.
2024-08-31 12:52:08 02684_bson: [ OK ] 0.19 sec.
2024-08-31 12:52:08 02681_comparsion_tuple_elimination_ast: [ OK ] 0.24 sec.
2024-08-31 12:52:08 02680_default_star: [ OK ] 0.20 sec.
2024-08-31 12:52:08 02681_aggregation_by_partitions_bug: [ OK ] 0.33 sec.
2024-08-31 12:52:08 02702_allow_skip_errors_enum: [ OK ] 2.20 sec.
2024-08-31 12:52:09 02680_datetime64_monotonic_check: [ OK ] 0.28 sec.
2024-08-31 12:52:09 02697_stop_reading_on_first_cancel: [ OK ] 1.77 sec.
2024-08-31 12:52:09 02679_query_parameters_dangling_pointer: [ OK ] 0.23 sec.
2024-08-31 12:52:09 02680_illegal_type_of_filter_projection: [ OK ] 0.29 sec.
2024-08-31 12:52:09 02678_explain_pipeline_graph_with_projection: [ OK ] 0.23 sec.
2024-08-31 12:52:09 02677_grace_hash_limit_race: [ OK ] 0.26 sec.
2024-08-31 12:52:09 02676_kafka_murmur_hash: [ OK ] 0.22 sec.
2024-08-31 12:52:09 02676_trailing_commas: [ OK ] 0.23 sec.
2024-08-31 12:52:09 02677_analyzer_compound_expressions: [ OK ] 0.34 sec.
2024-08-31 12:52:09 02675_predicate_push_down_filled_join_fix: [ OK ] 0.23 sec.
2024-08-31 12:52:09 02674_date_int_string_json_inference: [ OK ] 0.21 sec.
2024-08-31 12:52:09 02674_trivial_count_analyzer: [ OK ] 0.34 sec.
2024-08-31 12:52:09 02675_sparse_columns_clear_column: [ OK ] 0.49 sec.
2024-08-31 12:52:09 02669_alter_modify_to_nullable: [ OK ] 0.40 sec.
2024-08-31 12:52:10 02661_quantile_approx: [ OK ] 0.71 sec.
2024-08-31 12:52:10 02675_grant_query_formatting: [ OK ] 1.45 sec.
2024-08-31 12:52:11 02668_parse_datetime_in_joda_syntax: [ OK ] 1.50 sec.
2024-08-31 12:52:12 02681_undrop_query_uuid: [ OK ] 3.57 sec.
2024-08-31 12:52:12 02597_column_delete_and_replication: [ OK ] 1.24 sec.
2024-08-31 12:52:12 02596_build_set_and_remote: [ OK ] 0.40 sec.
2024-08-31 12:52:13 02597_projection_materialize_and_replication: [ OK ] 1.22 sec.
2024-08-31 12:52:15 02595_orc_arrow_parquet_more_types: [ OK ] 2.42 sec.
2024-08-31 12:52:15 02594_msgpack_more_types: [ OK ] 1.79 sec.
2024-08-31 12:52:16 02592_avro_records_with_same_names: [ OK ] 1.63 sec.
2024-08-31 12:52:16 02592_avro_more_types: [ OK ] 1.81 sec.
2024-08-31 12:52:17 02591_bson_long_tuple: [ OK ] 0.21 sec.
2024-08-31 12:52:19 02661_read_from_archive_targz: [ OK ] 9.27 sec.
2024-08-31 12:52:19 02661_read_from_archive_zip: [ OK ] 9.41 sec.
2024-08-31 12:52:19 02588_avro_date32_and_decimals: [ OK ] 2.39 sec.
2024-08-31 12:52:19 02586_generate_random_structure: [ OK ] 0.34 sec.
2024-08-31 12:52:19 02582_async_reading_with_small_limit: [ OK ] 0.24 sec.
2024-08-31 12:52:19 02582_analyzer_join_subquery_empty_column_list: [ OK ] 0.26 sec.
2024-08-31 12:52:19 02661_read_from_archive_tzst: [ OK ] 9.29 sec.
2024-08-31 12:52:20 02581_width_bucket: [ OK ] 0.44 sec.
2024-08-31 12:52:20 02661_read_from_archive_tar: [ OK ] 9.38 sec.
2024-08-31 12:52:20 02579_fill_empty_chunk_analyzer: [ OK ] 0.22 sec.
2024-08-31 12:52:20 02579_parameterized_replace: [ OK ] 0.20 sec.
2024-08-31 12:52:20 02578_ipv4_codec_t64: [ OK ] 0.19 sec.
2024-08-31 12:52:20 02577_keepermap_delete_update: [ OK ] 0.36 sec.
2024-08-31 12:52:20 02577_analyzer_array_join_calc_twice: [ OK ] 0.22 sec.
2024-08-31 12:52:20 02764_csv_trim_whitespaces: [ OK ] 22.02 sec.
2024-08-31 12:52:21 02575_map_hashing_msan: [ OK ] 0.26 sec.
2024-08-31 12:52:21 02575_merge_prewhere_materialized: [ OK ] 0.25 sec.
2024-08-31 12:52:21 02575_merge_prewhere_default_expression: [ OK ] 0.25 sec.
2024-08-31 12:52:21 02572_max_intersections: [ OK ] 0.20 sec.
2024-08-31 12:52:21 02574_suspicious_low_cardinality_msan: [ OK ] 0.29 sec.
2024-08-31 12:52:21 02581_share_big_sets_between_mutation_tasks_with_storage_set: [ OK ] 1.74 sec.
2024-08-31 12:52:21 02568_json_array_length: [ OK ] 0.25 sec.
2024-08-31 12:52:22 02584_compressor_codecs: [ OK ] 3.50 sec.
2024-08-31 12:52:22 02571_local_desc_abort_on_twitter_json: [ OK ] 1.56 sec.
2024-08-31 12:52:23 02566_analyzer_limit_settings_distributed: [ OK ] 0.27 sec.
2024-08-31 12:52:23 02565_update_empty_nested: [ OK ] 0.30 sec.
2024-08-31 12:52:23 02565_analyzer_limit_settings: [ OK ] 0.30 sec.
2024-08-31 12:52:23 02564_read_in_order_final_desc: [ OK ] 0.24 sec.
2024-08-31 12:52:23 02563_progress_when_no_rows_from_prewhere: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:52:23 02562_with_fill_nullable: [ OK ] 0.23 sec.
2024-08-31 12:52:23 02590_interserver_mode_client_info_initial_query_start_time: [ OK ] 6.69 sec.
2024-08-31 12:52:23 02567_native_type_conversions: [ OK ] 2.11 sec.
2024-08-31 12:52:24 02570_fallback_from_async_insert: [ OK ] 2.75 sec.
2024-08-31 12:52:24 02560_regexp_denial_of_service: [ OK ] 0.55 sec.
2024-08-31 12:52:25 02563_async_insert_bad_data: [ OK ] 2.07 sec.
2024-08-31 12:52:25 02560_analyzer_materialized_view: [ OK ] 0.27 sec.
2024-08-31 12:52:25 02560_count_digits: [ OK ] 0.23 sec.
2024-08-31 12:52:26 02560_quantile_min_max: [ OK ] 0.21 sec.
2024-08-31 12:52:26 02560_tuple_format: [ OK ] 1.75 sec.
2024-08-31 12:52:26 02560_window_ntile: [ OK ] 0.38 sec.
2024-08-31 12:52:27 02559_multiple_read_steps_in_prewhere_missing_columns_2: [ OK ] 0.23 sec.
2024-08-31 12:52:27 02561_sorting_constants_and_distinct_crash: [ OK ] 3.33 sec.
2024-08-31 12:52:27 02560_vertical_merge_memory_usage: [ OK ] 1.00 sec.
2024-08-31 12:52:27 02559_add_parts: [ OK ] 0.23 sec.
2024-08-31 12:52:27 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.22 sec.
2024-08-31 12:52:27 02572_query_views_log_background_thread: [ OK ] 6.29 sec.
2024-08-31 12:52:27 02562_native_tskv_default_for_omitted_fields: [ OK ] 3.93 sec.
2024-08-31 12:52:27 02554_invalid_create_view_syntax: [ OK ] 0.18 sec.
2024-08-31 12:52:27 02554_format_json_columns_for_empty: [ OK ] 0.23 sec.
2024-08-31 12:52:27 02553_type_object_analyzer: [ OK ] 0.24 sec.
2024-08-31 12:52:27 02552_client_format_settings: [ OK ] 0.21 sec.
2024-08-31 12:52:27 02554_log_faminy_support_storage_policy: [ OK ] 0.30 sec.
2024-08-31 12:52:27 02561_temporary_table_grants: [ OK ] 3.92 sec.
2024-08-31 12:52:28 02552_analyzer_optimize_group_by_function_keys_crash: [ OK ] 0.22 sec.
2024-08-31 12:52:28 02551_ipv4_implicit_uint64: [ OK ] 0.23 sec.
2024-08-31 12:52:28 02541_empty_function_support_ip: [ OK ] 0.22 sec.
2024-08-31 12:52:28 02556_local_with_totals_and_extremes: [ OK ] 1.58 sec.
2024-08-31 12:52:28 02540_date_column_consistent_insert_behaviour: [ OK ] 0.52 sec.
2024-08-31 12:52:29 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 0.27 sec.
2024-08-31 12:52:29 02540_duplicate_primary_key2: [ OK ] 0.24 sec.
2024-08-31 12:52:29 02539_generate_random_ip: [ OK ] 0.22 sec.
2024-08-31 12:52:29 02551_obfuscator_keywords: [ OK ] 1.77 sec.
2024-08-31 12:52:29 02539_vertical_merge_compact_parts: [ OK ] 0.54 sec.
2024-08-31 12:52:30 02538_alter_rename_sequence: [ OK ] 0.38 sec.
2024-08-31 12:52:30 02538_analyzer_create_table_as_select: [ OK ] 0.23 sec.
2024-08-31 12:52:30 02581_share_big_sets_between_mutation_tasks: [ OK ] 10.40 sec.
2024-08-31 12:52:30 02536_date_from_number_inference_fix: [ OK ] 0.23 sec.
2024-08-31 12:52:30 02535_analyzer_limit_offset: [ OK ] 0.21 sec.
2024-08-31 12:52:30 02535_ip_parser_not_whole: [ OK ] 0.21 sec.
2024-08-31 12:52:30 02534_join_prewhere_bug: [ OK ] 0.27 sec.
2024-08-31 12:52:30 02533_generate_random_schema_inference: [ OK ] 0.20 sec.
2024-08-31 12:52:32 02539_settings_alias: [ OK ] 3.29 sec.
2024-08-31 12:52:32 02535_json_bson_each_row_curl: [ OK ] 2.23 sec.
2024-08-31 12:52:32 02531_ipv4_arithmetic: [ OK ] 0.21 sec.
2024-08-31 12:52:32 02532_send_logs_level_test: [ OK ] 1.86 sec.
2024-08-31 12:52:32 02526_kv_engine_different_filter_type: [ OK ] 0.27 sec.
2024-08-31 12:52:33 02525_different_engines_in_temporary_tables: [ OK ] 0.31 sec.
2024-08-31 12:52:33 02525_analyzer_function_in_crash_fix: [ OK ] 0.22 sec.
2024-08-31 12:52:33 02703_max_local_read_bandwidth: [ OK ] 26.45 sec.
2024-08-31 12:52:33 02524_fuzz_and_fuss: [ OK ] 0.21 sec.
2024-08-31 12:52:33 02523_range_const_start: [ OK ] 0.21 sec.
2024-08-31 12:52:33 02522_different_types_in_storage_merge: [ OK ] 0.23 sec.
2024-08-31 12:52:33 02521_analyzer_array_join_crash: [ OK ] 0.27 sec.
2024-08-31 12:52:33 02534_parquet_fixed_binary_array: [ OK ] 3.41 sec.
2024-08-31 12:52:34 02520_group_array_last: [ OK ] 0.38 sec.
2024-08-31 12:52:34 02543_alter_update_rename_stuck: [ OK ] 6.05 sec.
2024-08-31 12:52:34 02518_delete_on_materialized_view: [ OK ] 0.26 sec.
2024-08-31 12:52:34 02531_two_level_aggregation_bug: [ OK ] 1.93 sec.
2024-08-31 12:52:34 02517_uuid_parsing: [ OK ] 0.23 sec.
2024-08-31 12:52:35 02517_avro_bool_type: [ OK ] 1.54 sec.
2024-08-31 12:52:35 02515_tuple_lambda_parsing: [ OK ] 0.22 sec.
2024-08-31 12:52:36 02518_parquet_arrow_orc_boolean_value: [ OK ] 2.02 sec.
2024-08-31 12:52:36 02515_projections_with_totals: [ OK ] 0.25 sec.
2024-08-31 12:52:36 02555_davengers_rename_chain: [ OK ] 8.91 sec.
2024-08-31 12:52:36 02516_projections_with_rollup: [ OK ] 1.77 sec.
2024-08-31 12:52:36 02515_analyzer_null_for_empty: [ OK ] 0.20 sec.
2024-08-31 12:52:36 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.21 sec.
2024-08-31 12:52:36 02515_aggregate_functions_statistics: [ OK ] 0.35 sec.
2024-08-31 12:52:36 02514_tsv_zero_started_number: [ OK ] 0.21 sec.
2024-08-31 12:52:36 02514_bad_index_granularity: [ OK ] 0.24 sec.
2024-08-31 12:52:36 02513_broken_datetime64_init_on_mac: [ OK ] 0.23 sec.
2024-08-31 12:52:36 02510_group_by_prewhere_null: [ OK ] 0.23 sec.
2024-08-31 12:52:36 02513_prewhere_combine_step_filters: [ OK ] 0.31 sec.
2024-08-31 12:52:36 02508_index_analysis_to_date_timezone: [ OK ] 0.25 sec.
2024-08-31 12:52:36 02507_to_unix_timestamp_overflow: [ OK ] 0.25 sec.
2024-08-31 12:52:36 02504_disallow_arrayjoin_in_mutations: [ OK ] 0.24 sec.
2024-08-31 12:52:37 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.22 sec.
2024-08-31 12:52:37 02503_join_switch_alias_fuzz: [ OK ] 0.21 sec.
2024-08-31 12:52:37 02503_in_lc_const_args_bug: [ OK ] 0.22 sec.
2024-08-31 12:52:37 02502_analyzer_insert_select_crash_fix: [ OK ] 0.24 sec.
2024-08-31 12:52:37 02501_analyzer_expired_context_crash_fix: [ OK ] 0.23 sec.
2024-08-31 12:52:37 02500_analyzer_storage_view_crash_fix: [ OK ] 0.24 sec.
2024-08-31 12:52:37 02499_analyzer_set_index: [ OK ] 0.22 sec.
2024-08-31 12:52:37 02499_escaped_quote_schema_inference: [ OK ] 0.20 sec.
2024-08-31 12:52:37 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 3.52 sec.
2024-08-31 12:52:37 02497_source_part_is_intact_when_mutation: [ OK ] 0.30 sec.
2024-08-31 12:52:38 02497_having_without_actual_aggregation_bug: [ OK ] 0.28 sec.
2024-08-31 12:52:38 02498_storage_join_key_positions: [ OK ] 0.79 sec.
2024-08-31 12:52:38 02497_if_transform_strings_to_enum: [ OK ] 0.38 sec.
2024-08-31 12:52:39 02500_bson_read_object_id: [ OK ] 1.90 sec.
2024-08-31 12:52:39 02498_random_string_in_json_schema_inference: [ OK ] 1.57 sec.
2024-08-31 12:52:39 02495_concat_with_separator: [ OK ] 0.41 sec.
2024-08-31 12:52:39 02494_optimize_group_by_function_keys_and_alias_columns: [ OK ] 0.26 sec.
2024-08-31 12:52:40 02494_parser_string_binary_literal: [ OK ] 0.26 sec.
2024-08-31 12:52:40 02496_row_binary_large_string_size: [ OK ] 1.66 sec.
2024-08-31 12:52:40 02494_analyzer_compound_expression_crash_fix: [ OK ] 0.24 sec.
2024-08-31 12:52:40 02494_array_function_range: [ OK ] 0.24 sec.
2024-08-31 12:52:40 02550_client_connections_credentials: [ OK ] 12.85 sec.
2024-08-31 12:52:40 02493_analyzer_sum_if_to_count_if: [ OK ] 0.24 sec.
2024-08-31 12:52:41 02493_numeric_literals_with_underscores: [ OK ] 0.51 sec.
2024-08-31 12:52:42 02493_max_streams_for_merge_tree_reading: [ OK ] 1.10 sec.
2024-08-31 12:52:42 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 9.00 sec.
2024-08-31 12:52:42 02493_do_not_assume_that_the_original_query_was_valid_when_transforming_joins: [ OK ] 0.27 sec.
2024-08-31 12:52:42 02493_analyzer_table_functions_untuple: [ OK ] 0.26 sec.
2024-08-31 12:52:42 02491_part_log_has_table_uuid: [ OK ] 0.53 sec.
2024-08-31 12:52:43 02489_analyzer_indexes: [ OK ] 0.35 sec.
2024-08-31 12:52:43 02490_replacing_merge_tree_is_deleted_column: [ OK ] 0.81 sec.
2024-08-31 12:52:43 02493_inconsistent_hex_and_binary_number: [ OK ] 2.62 sec.
2024-08-31 12:52:43 02487_create_index_normalize_functions: [ OK ] 0.29 sec.
2024-08-31 12:52:43 02482_execute_functions_before_sorting_bug: [ OK ] 0.24 sec.
2024-08-31 12:52:45 02486_truncate_and_unexpected_parts: [ OK ] 1.37 sec.
2024-08-31 12:52:45 02482_insert_into_dist_race: [ OK ] 0.30 sec.
2024-08-31 12:52:45 02482_value_block_parsing: [ OK ] 1.74 sec.
2024-08-31 12:52:45 02481_low_cardinality_with_short_circuit_functins: [ OK ] 0.34 sec.
2024-08-31 12:52:45 02521_tsv_csv_custom_header_detection: [ OK ] 12.54 sec.
2024-08-31 12:52:45 02494_zero_copy_and_projection_and_mutation_work_together: [ OK ] 5.43 sec.
2024-08-31 12:52:46 02481_analyzer_optimize_grouping_sets_keys: [ OK ] 0.23 sec.
2024-08-31 12:52:46 02481_i43247_ubsan_in_minmaxany: [ OK ] 0.29 sec.
2024-08-31 12:52:46 02481_default_value_used_in_row_level_filter: [ OK ] 0.27 sec.
2024-08-31 12:52:46 02481_xxh3_hash_function: [ OK ] 0.23 sec.
2024-08-31 12:52:46 02500_remove_redundant_distinct_analyzer: [ OK ] 9.08 sec.
2024-08-31 12:52:46 02481_analyzer_optimize_aggregation_arithmetics: [ OK ] 0.64 sec.
2024-08-31 12:52:46 02481_pk_analysis_with_enum_to_string: [ OK ] 0.45 sec.
2024-08-31 12:52:46 02480_analyzer_alias_nullptr: [ OK ] 0.28 sec.
2024-08-31 12:52:46 02480_suspicious_lowcard_in_key: [ OK ] 0.24 sec.
2024-08-31 12:52:46 02479_if_with_null_and_cullable_const: [ OK ] 0.21 sec.
2024-08-31 12:52:46 02479_nullable_primary_key_non_first_column: [ OK ] 0.28 sec.
2024-08-31 12:52:47 02479_mysql_connect_to_self: [ OK ] 0.50 sec.
2024-08-31 12:52:47 02479_analyzer_aggregation_crash: [ OK ] 0.25 sec.
2024-08-31 12:52:47 02478_analyzer_table_expression_aliases: [ OK ] 0.31 sec.
2024-08-31 12:52:47 02488_zero_copy_detached_parts_drop_table: [ OK ] 4.01 sec.
2024-08-31 12:52:47 02478_window_frame_type_groups: [ OK ] 0.28 sec.
2024-08-31 12:52:47 02496_remove_redundant_sorting: [ OK ] 9.03 sec.
2024-08-31 12:52:47 02477_exists_fuzz_43478: [ OK ] 0.22 sec.
2024-08-31 12:52:47 02477_age_datetime64: [ OK ] 0.32 sec.
2024-08-31 12:52:47 02477_invalid_reads: [ OK ] 0.62 sec.
2024-08-31 12:52:47 02477_age_date32: [ OK ] 0.39 sec.
2024-08-31 12:52:47 02477_analyzer_array_join_with_join: [ OK ] 0.41 sec.
2024-08-31 12:52:47 02480_tets_show_full: [ OK ] 1.85 sec.
2024-08-31 12:52:47 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 0.26 sec.
2024-08-31 12:52:47 02477_age: [ OK ] 0.37 sec.
2024-08-31 12:52:47 02476_analyzer_join_with_unused_columns: [ OK ] 0.25 sec.
2024-08-31 12:52:48 02476_fuse_sum_count: [ OK ] 0.34 sec.
2024-08-31 12:52:48 02496_remove_redundant_sorting_analyzer: [ OK ] 9.11 sec.
2024-08-31 12:52:48 02476_fix_cast_parser_bug: [ OK ] 0.19 sec.
2024-08-31 12:52:48 02476_query_parameters_without_serialisation: [ OK ] 0.27 sec.
2024-08-31 12:52:48 02475_or_function_alias_and_const_where: [ OK ] 0.22 sec.
2024-08-31 12:52:48 02475_join_bug_42832: [ OK ] 0.26 sec.
2024-08-31 12:52:48 02475_analyzer_join_tree_subquery: [ OK ] 0.20 sec.
2024-08-31 12:52:48 02475_analysis_of_variance: [ OK ] 0.34 sec.
2024-08-31 12:52:48 02475_precise_decimal_arithmetics: [ OK ] 0.42 sec.
2024-08-31 12:52:48 02474_fix_function_parser_bug: [ OK ] 0.18 sec.
2024-08-31 12:52:48 02474_extract_fixedstring_from_json: [ OK ] 0.23 sec.
2024-08-31 12:52:48 02474_timeDiff_UTCTimestamp: [ OK ] 0.22 sec.
2024-08-31 12:52:48 02473_extract_low_cardinality_from_json: [ OK ] 0.21 sec.
2024-08-31 12:52:48 02472_segfault_expression_parser: [ OK ] 0.17 sec.
2024-08-31 12:52:49 02480_client_option_print_num_processed_rows: [ OK ] 2.57 sec.
2024-08-31 12:52:49 02471_wrong_date_monotonicity: [ OK ] 0.23 sec.
2024-08-31 12:52:49 02470_suspicious_low_cardinality_msan: [ OK ] 0.31 sec.
2024-08-31 12:52:49 02469_interval_msan: [ OK ] 0.30 sec.
2024-08-31 12:52:49 02464_decimal_scale_buffer_overflow: [ OK ] 0.22 sec.
2024-08-31 12:52:49 02465_limit_trivial_max_rows_to_read: [ OK ] 0.28 sec.
2024-08-31 12:52:49 02476_fix_lambda_parsing: [ OK ] 1.82 sec.
2024-08-31 12:52:49 02461_welch_t_test_fuzz: [ OK ] 0.23 sec.
2024-08-31 12:52:50 02466_distributed_query_profiler: [ OK ] 1.08 sec.
2024-08-31 12:52:50 02461_alter_update_respect_part_column_type_bug: [ OK ] 0.71 sec.
2024-08-31 12:52:50 02461_mullable_pk_monotonicity_bug: [ OK ] 0.52 sec.
2024-08-31 12:52:50 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 0.89 sec.
2024-08-31 12:52:50 02477_s3_request_throttler: [ OK ] 3.38 sec.
2024-08-31 12:52:50 02458_datediff_date32: [ OK ] 0.47 sec.
2024-08-31 12:52:51 02458_empty_hdfs_url: [ OK ] 0.22 sec.
2024-08-31 12:52:51 02458_key_condition_not_like_prefix: [ OK ] 0.30 sec.
2024-08-31 12:52:51 02457_tuple_of_intervals: [ OK ] 0.37 sec.
2024-08-31 12:52:51 02457_filesystem_function: [ OK ] 0.24 sec.
2024-08-31 12:52:51 02457_morton_coding: [ OK ] 0.50 sec.
2024-08-31 12:52:51 02457_parse_date_time_best_effort: [ OK ] 0.34 sec.
2024-08-31 12:52:53 02456_keeper_retries_during_insert: [ OK ] 1.75 sec.
2024-08-31 12:52:53 02456_alter-nullable-column-bag: [ OK ] 0.41 sec.
2024-08-31 12:52:54 02458_insert_select_progress_tcp: [ OK ] 4.22 sec.
2024-08-31 12:52:54 02456_bloom_filter_assert: [ OK ] 0.93 sec.
2024-08-31 12:52:54 02457_csv_parse_date_out_of_range: [ OK ] 3.60 sec.
2024-08-31 12:52:55 02456_alter-nullable-column-bag-2: [ OK ] 0.36 sec.
2024-08-31 12:52:55 02456_aggregate_state_conversion: [ OK ] 0.34 sec.
2024-08-31 12:52:55 02455_duplicate_column_names_in_schema_inference: [ OK ] 0.36 sec.
2024-08-31 12:52:55 02456_test_zero_copy_mutation: [ OK ] 0.54 sec.
2024-08-31 12:52:55 02455_improve_feedback_when_replacing_partition_with_different_primary_key: [ OK ] 0.31 sec.
2024-08-31 12:52:56 02455_extract_fixed_string_from_nested_json: [ OK ] 0.42 sec.
2024-08-31 12:52:56 02454_compressed_marks_in_compact_part: [ OK ] 0.53 sec.
2024-08-31 12:52:57 02454_create_table_with_custom_disk: [ OK ] 0.60 sec.
2024-08-31 12:52:58 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 0.62 sec.
2024-08-31 12:52:58 02451_variadic_null_garbage_data: [ OK ] 0.52 sec.
2024-08-31 12:52:58 02456_async_inserts_logs: [ OK ] 7.14 sec.
2024-08-31 12:52:58 02454_set_parameters_formatting: [ OK ] 3.15 sec.
2024-08-31 12:52:59 02455_default_union_except_intersect: [ OK ] 3.70 sec.
2024-08-31 12:52:59 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 0.64 sec.
2024-08-31 12:52:59 02436_system_zookeeper_context: [ OK ] 0.42 sec.
2024-08-31 12:53:00 02433_default_expression_operator_in: [ OK ] 0.48 sec.
2024-08-31 12:53:00 02430_initialize_aggregation_with_combinators: [ OK ] 0.36 sec.
2024-08-31 12:53:02 02440_mutations_finalization: [ OK ] 3.46 sec.
2024-08-31 12:53:02 02429_combinators_in_array_reduce: [ OK ] 0.37 sec.
2024-08-31 12:53:03 02429_low_cardinality_trash: [ OK ] 2.18 sec.
2024-08-31 12:53:04 02428_index_analysis_with_null_literal: [ OK ] 1.18 sec.
2024-08-31 12:53:04 02439_merge_selecting_partitions: [ OK ] 5.14 sec.
2024-08-31 12:53:04 02428_combinators_with_over_statement: [ OK ] 0.52 sec.
2024-08-31 12:53:05 02476_analyzer_identifier_hints: [ OK ] 17.32 sec.
2024-08-31 12:53:05 02428_delete_with_settings: [ OK ] 0.84 sec.
2024-08-31 12:53:05 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 0.61 sec.
2024-08-31 12:53:05 02426_pod_array_overflow_3: [ OK ] 0.29 sec.
2024-08-31 12:53:05 02426_pod_array_overflow_2: [ OK ] 0.37 sec.
2024-08-31 12:53:05 02473_multistep_split_prewhere: [ OK ] 17.21 sec.
2024-08-31 12:53:06 02426_to_string_nullable_fixedstring: [ OK ] 0.29 sec.
2024-08-31 12:53:06 02424_pod_array_overflow: [ OK ] 0.41 sec.
2024-08-31 12:53:06 02422_insert_different_granularity: [ OK ] 0.57 sec.
2024-08-31 12:53:07 02444_async_broken_outdated_part_loading: [ OK ] 8.41 sec.
2024-08-31 12:53:07 02422_read_numbers_as_strings: [ OK ] 0.37 sec.
2024-08-31 12:53:08 02426_orc_bug: [ OK ] 2.85 sec.
2024-08-31 12:53:13 02473_multistep_prewhere: [ OK ] 24.77 sec.
2024-08-31 12:53:13 02421_type_json_async_insert: [ OK ] 5.12 sec.
2024-08-31 12:53:14 02421_json_decimals_as_strings: [ OK ] 0.53 sec.
2024-08-31 12:53:15 02423_insert_stats_behaviour: [ OK ] 8.79 sec.
2024-08-31 12:53:15 02418_keeper_map_keys_limit: [ OK ] 0.52 sec.
2024-08-31 12:53:16 02421_simple_queries_for_opentelemetry: [ OK ] 8.86 sec.
2024-08-31 12:53:16 02417_null_variadic_behaviour: [ OK ] 0.83 sec.
2024-08-31 12:53:16 02416_json_tuple_to_array_schema_inference: [ OK ] 0.48 sec.
2024-08-31 12:53:17 02416_keeper_map: [ OK ] 0.64 sec.
2024-08-31 12:53:17 02415_all_new_functions_must_be_documented: [ OK ] 0.33 sec.
2024-08-31 12:53:17 02416_rocksdb_delete_update: [ OK ] 0.78 sec.
2024-08-31 12:53:17 02420_stracktrace_debug_symbols: [ OK ] 3.43 sec.
2024-08-31 12:53:18 02414_all_new_table_functions_must_be_documented: [ OK ] 0.41 sec.
2024-08-31 12:53:18 02409_url_format_detection: [ OK ] 0.33 sec.
2024-08-31 12:53:18 02408_to_fixed_string_short_circuit: [ OK ] 0.31 sec.
2024-08-31 12:53:18 02412_nlp: [ OK ] 0.56 sec.
2024-08-31 12:53:18 02407_array_element_from_map_wrong_type: [ OK ] 0.37 sec.
2024-08-31 12:53:19 02402_merge_engine_with_view: [ OK ] 0.59 sec.
2024-08-31 12:53:19 02398_subquery_where_pushdown_and_limit_offset: [ OK ] 0.55 sec.
2024-08-31 12:53:19 02400_memory_accounting_on_error: [ OK ] 1.00 sec.
2024-08-31 12:53:19 02394_every_profile_event_must_have_documentation: [ OK ] 0.51 sec.
2024-08-31 12:53:19 02392_every_setting_must_have_documentation: [ OK ] 0.40 sec.
2024-08-31 12:53:20 02387_parse_date_as_datetime: [ OK ] 0.53 sec.
2024-08-31 12:53:20 02385_analyzer_aliases_compound_expression: [ OK ] 0.39 sec.
2024-08-31 12:53:20 02383_join_and_filtering_set: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:53:20 02383_schema_inference_hints: [ OK ] 0.30 sec.
2024-08-31 12:53:20 02384_analyzer_dict_get_join_get: [ OK ] 0.59 sec.
2024-08-31 12:53:21 02423_ddl_for_opentelemetry: [ OK ] 15.37 sec.
2024-08-31 12:53:21 02383_array_signed_const_positive_index: [ OK ] 0.58 sec.
2024-08-31 12:53:21 02461_cancel_finish_race: [ OK ] 31.32 sec.
2024-08-31 12:53:21 02382_join_and_filtering_set: [ OK ] 0.48 sec.
2024-08-31 12:53:22 02382_analyzer_matcher_join_using: [ OK ] 0.46 sec.
2024-08-31 12:53:22 02381_parse_array_of_tuples: [ OK ] 0.26 sec.
2024-08-31 12:53:22 02381_parseDateTime64BestEffortUS: [ OK ] 0.23 sec.
2024-08-31 12:53:22 02381_analyzer_join_final: [ OK ] 0.26 sec.
2024-08-31 12:53:23 02381_join_dup_columns_in_plan: [ OK ] 0.40 sec.
2024-08-31 12:53:23 02381_client_prints_server_side_time: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:53:23 02381_arrow_dict_to_lc: [ OK ] 1.57 sec.
2024-08-31 12:53:23 02381_compress_marks_and_primary_key: [ OK ] 1.23 sec.
2024-08-31 12:53:23 02380_analyzer_join_sample: [ OK ] 0.26 sec.
2024-08-31 12:53:23 02377_analyzer_in_function_set: [ OK ] 0.23 sec.
2024-08-31 12:53:24 02377_optimize_sorting_by_input_stream_properties: [ OK ] 0.34 sec.
2024-08-31 12:53:24 02378_part_log_profile_events: [ OK ] 0.79 sec.
2024-08-31 12:53:24 02376_analyzer_in_function_subquery: [ OK ] 0.32 sec.
2024-08-31 12:53:24 02377_modify_column_from_lc: [ OK ] 0.42 sec.
2024-08-31 12:53:24 02375_scalar_lc_cte: [ OK ] 0.21 sec.
2024-08-31 12:53:24 02383_arrow_dict_special_cases: [ OK ] 3.89 sec.
2024-08-31 12:53:24 02375_pretty_formats: [ OK ] 0.26 sec.
2024-08-31 12:53:24 02374_in_tuple_index: [ OK ] 0.24 sec.
2024-08-31 12:53:25 02374_combine_multi_if_and_count_if_opt: [ OK ] 0.25 sec.
2024-08-31 12:53:25 02389_analyzer_nested_lambda: [ OK ] 5.88 sec.
2024-08-31 12:53:25 02374_analyzer_array_join: [ OK ] 0.66 sec.
2024-08-31 12:53:25 02380_insert_mv_race: [ OK ] 2.68 sec.
2024-08-31 12:53:25 02371_create_temporary_table_as_with_columns_list: [ OK ] 0.21 sec.
2024-08-31 12:53:26 02372_now_in_block: [ OK ] 0.69 sec.
2024-08-31 12:53:26 02374_analyzer_join_using: [ OK ] 1.37 sec.
2024-08-31 12:53:26 02370_analyzer_in_function: [ OK ] 0.28 sec.
2024-08-31 12:53:26 02369_analyzer_array_join_function: [ OK ] 0.29 sec.
2024-08-31 12:53:26 02368_analyzer_table_functions: [ OK ] 0.23 sec.
2024-08-31 12:53:26 02367_analyzer_table_alias_columns: [ OK ] 0.27 sec.
2024-08-31 12:53:26 02366_normalize_aggregate_function_types_and_states: [ OK ] 0.26 sec.
2024-08-31 12:53:26 02366_kql_native_interval_format: [ OK ] 0.25 sec.
2024-08-31 12:53:27 02366_asof_optimize_predicate_bug_37813: [ OK ] 0.24 sec.
2024-08-31 12:53:27 02366_kql_mvexpand: [ OK ] 0.31 sec.
2024-08-31 12:53:27 02366_kql_create_table: [ OK ] 0.25 sec.
2024-08-31 12:53:27 02366_kql_tabular: [ OK ] 0.33 sec.
2024-08-31 12:53:27 02366_kql_operator_in_sql: [ OK ] 0.32 sec.
2024-08-31 12:53:27 02366_window_function_order_by: [ OK ] 0.23 sec.
2024-08-31 12:53:27 02366_explain_query_tree: [ OK ] 0.24 sec.
2024-08-31 12:53:27 02372_analyzer_join: [ OK ] 2.33 sec.
2024-08-31 12:53:28 02366_kql_func_math: [ OK ] 0.28 sec.
2024-08-31 12:53:28 02366_kql_summarize: [ OK ] 0.47 sec.
2024-08-31 12:53:28 02373_datetime64_monotonicity: [ OK ] 3.33 sec.
2024-08-31 12:53:28 02366_kql_distinct: [ OK ] 0.25 sec.
2024-08-31 12:53:28 02364_window_case: [ OK ] 0.20 sec.
2024-08-31 12:53:28 02364_dictionary_datetime_64_attribute_crash: [ OK ] 0.24 sec.
2024-08-31 12:53:28 02366_kql_func_ip: [ OK ] 0.93 sec.
2024-08-31 12:53:29 02366_kql_func_dynamic: [ OK ] 0.78 sec.
2024-08-31 12:53:30 02359_send_logs_source_regexp: [ OK ] 1.60 sec.
2024-08-31 12:53:30 02360_send_logs_level_colors: [ OK ] 2.03 sec.
2024-08-31 12:53:31 02358_file_default_value: [ OK ] 1.96 sec.
2024-08-31 12:53:31 02356_insert_query_log_metrics: [ OK ] 0.39 sec.
2024-08-31 12:53:31 02421_truncate_isolation_no_merges: [ OK ] 24.15 sec.
2024-08-31 12:53:31 02354_vector_search_bugs: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:53:31 02354_vector_search_default_granularity: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:53:31 02354_vector_search_queries: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:53:31 02361_fsync_profile_events: [ OK ] 2.74 sec.
2024-08-31 12:53:31 02355_column_type_name_lc: [ OK ] 0.22 sec.
2024-08-31 12:53:31 02355_control_block_size_in_array_join: [ OK ] 0.33 sec.
2024-08-31 12:53:31 02354_numeric_literals_with_underscores: [ OK ] 0.22 sec.
2024-08-31 12:53:31 02354_with_statement_non_exist_column: [ OK ] 0.20 sec.
2024-08-31 12:53:31 02354_tuple_element_with_default: [ OK ] 0.25 sec.
2024-08-31 12:53:31 02354_window_expression_with_aggregation_expression: [ OK ] 0.26 sec.
2024-08-31 12:53:31 02353_ascii: [ OK ] 0.24 sec.
2024-08-31 12:53:31 02428_parameterized_view: [ OK ] 29.02 sec.
2024-08-31 12:53:31 02353_isnullable: [ OK ] 0.20 sec.
2024-08-31 12:53:32 02353_partition_prune_nullable_key: [ OK ] 0.22 sec.
2024-08-31 12:53:32 02354_parse_timedelta: [ OK ] 0.58 sec.
2024-08-31 12:53:32 02353_translate: [ OK ] 0.30 sec.
2024-08-31 12:53:32 02352_grouby_shadows_arg: [ OK ] 0.26 sec.
2024-08-31 12:53:32 02354_read_in_order_prewhere: [ OK ] 0.66 sec.
2024-08-31 12:53:32 02347_rank_corr_nan: [ OK ] 0.22 sec.
2024-08-31 12:53:32 02351_Map_combinator_dist: [ OK ] 0.35 sec.
2024-08-31 12:53:32 02346_inverted_index_match_predicate: [ OK ] 0.27 sec.
2024-08-31 12:53:32 02346_to_hour_monotonicity_fix: [ OK ] 0.24 sec.
2024-08-31 12:53:32 02421_truncate_isolation_with_mutations: [ OK ] 19.20 sec.
2024-08-31 12:53:32 02346_position_countsubstrings_zero_byte: [ OK ] 0.29 sec.
2024-08-31 12:53:32 02346_inverted_index_bug52019: [ OK ] 0.28 sec.
2024-08-31 12:53:32 02346_inverted_index_bug47393: [ OK ] 0.26 sec.
2024-08-31 12:53:33 02345_create_table_allow_trailing_comma: [ OK ] 0.26 sec.
2024-08-31 12:53:33 02345_analyzer_subqueries: [ OK ] 0.31 sec.
2024-08-31 12:53:33 02344_analyzer_multiple_aliases_for_expression: [ OK ] 0.33 sec.
2024-08-31 12:53:33 02352_interactive_queries_from_file: [ OK ] 1.73 sec.
2024-08-31 12:53:34 02343_group_by_use_nulls: [ OK ] 0.37 sec.
2024-08-31 12:53:34 02344_distinct_limit_distiributed: [ OK ] 0.74 sec.
2024-08-31 12:53:34 02345_filesystem_local: [ OK ] 1.71 sec.
2024-08-31 12:53:34 02343_analyzer_column_transformers_strict: [ OK ] 0.28 sec.
2024-08-31 12:53:34 02343_aggregation_pipeline: [ OK ] 0.32 sec.
2024-08-31 12:53:34 02342_window_view_different_struct: [ OK ] 0.30 sec.
2024-08-31 12:53:34 02340_union_header: [ OK ] 0.20 sec.
2024-08-31 12:53:34 02341_global_join_cte: [ OK ] 0.34 sec.
2024-08-31 12:53:35 02337_check_translate_qualified_names_matcher: [ OK ] 0.22 sec.
2024-08-31 12:53:35 02340_analyzer_functions: [ OK ] 0.28 sec.
2024-08-31 12:53:35 02344_describe_cache: [ OK ] 2.07 sec.
2024-08-31 12:53:35 02346_into_outfile_and_stdout: [ OK ] 3.06 sec.
2024-08-31 12:53:35 02337_join_analyze_stuck: [ OK ] 0.41 sec.
2024-08-31 12:53:35 02336_sort_optimization_with_fill: [ OK ] 0.22 sec.
2024-08-31 12:53:35 02326_numbers_from_json_strings_schema_inference: [ OK ] 0.25 sec.
2024-08-31 12:53:35 02325_compatibility_setting_2: [ OK ] 0.27 sec.
2024-08-31 12:53:35 02325_dates_schema_inference: [ OK ] 0.32 sec.
2024-08-31 12:53:35 02324_map_combinator_bug: [ OK ] 0.30 sec.
2024-08-31 12:53:35 02319_dict_get_check_arguments_size: [ OK ] 0.36 sec.
2024-08-31 12:53:36 02317_functions_with_nothing: [ OK ] 0.24 sec.
2024-08-31 12:53:36 02319_sql_standard_create_drop_index: [ OK ] 0.35 sec.
2024-08-31 12:53:36 02335_column_ttl_expired_column_optimization: [ OK ] 1.63 sec.
2024-08-31 12:53:37 02332_dist_insert_send_logs_level: [ OK ] 1.75 sec.
2024-08-31 12:53:37 02316_cast_to_ip_address_default_column: [ OK ] 0.27 sec.
2024-08-31 12:53:37 02317_distinct_in_order_optimization: [ OK ] 0.81 sec.
2024-08-31 12:53:37 02316_const_string_intersact: [ OK ] 0.22 sec.
2024-08-31 12:53:37 02316_values_table_func_bug: [ OK ] 0.19 sec.
2024-08-31 12:53:37 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 0.43 sec.
2024-08-31 12:53:37 02315_pmj_union_ubsan_35857: [ OK ] 0.24 sec.
2024-08-31 12:53:37 02315_optimize_monotonous_functions_in_order_by_remote: [ OK ] 0.23 sec.
2024-08-31 12:53:37 02313_cross_join_dup_col_names: [ OK ] 0.23 sec.
2024-08-31 12:53:37 02357_query_cancellation_race: [ OK ] 7.36 sec.
2024-08-31 12:53:37 02311_normalize_utf8_constant: [ OK ] 0.20 sec.
2024-08-31 12:53:38 02312_parquet_orc_arrow_names_tuples: [ OK ] 0.33 sec.
2024-08-31 12:53:38 02313_test_fpc_codec: [ OK ] 0.36 sec.
2024-08-31 12:53:38 02311_range_hashed_dictionary_range_cast: [ OK ] 0.27 sec.
2024-08-31 12:53:38 02311_create_table_with_unknown_format: [ OK ] 0.31 sec.
2024-08-31 12:53:38 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 0.31 sec.
2024-08-31 12:53:38 02324_compatibility_setting: [ OK ] 2.94 sec.
2024-08-31 12:53:38 02310_generate_multi_columns_with_uuid: [ OK ] 0.22 sec.
2024-08-31 12:53:38 02306_window_move_row_number_fix: [ OK ] 0.23 sec.
2024-08-31 12:53:38 02311_system_zookeeper_insert: [ OK ] 0.42 sec.
2024-08-31 12:53:38 02304_grouping_set_order_by: [ OK ] 0.22 sec.
2024-08-31 12:53:38 02315_readonly_create_function: [ OK ] 1.54 sec.
2024-08-31 12:53:38 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.28 sec.
2024-08-31 12:53:38 02302_clash_const_aggegate_join: [ OK ] 0.28 sec.
2024-08-31 12:53:39 02296_nullable_arguments_in_array_filter: [ OK ] 0.22 sec.
2024-08-31 12:53:39 02294_optimize_aggregation_in_order_prefix_Array_functions: [ OK ] 0.24 sec.
2024-08-31 12:53:39 02295_GROUP_BY_AggregateFunction: [ OK ] 0.32 sec.
2024-08-31 12:53:39 02294_decimal_second_errors: [ OK ] 0.22 sec.
2024-08-31 12:53:39 02294_system_certificates: [ OK ] 0.22 sec.
2024-08-31 12:53:39 02346_read_in_order_fixed_prefix: [ OK ] 7.05 sec.
2024-08-31 12:53:39 02294_dictionaries_hierarchical_index: [ OK ] 0.33 sec.
2024-08-31 12:53:39 02306_rowbinary_has_no_bom: [ OK ] 1.37 sec.
2024-08-31 12:53:39 02293_h3_hex_ring: [ OK ] 0.35 sec.
2024-08-31 12:53:40 02293_h3_line: [ OK ] 0.33 sec.
2024-08-31 12:53:40 02301_harmful_reexec: [ OK ] 1.85 sec.
2024-08-31 12:53:40 02293_grouping_function_group_by: [ OK ] 0.44 sec.
2024-08-31 12:53:40 02370_lost_part_intersecting_merges: [ OK ] 14.71 sec.
2024-08-31 12:53:40 02292_nested_not_flattened_detach: [ OK ] 0.21 sec.
2024-08-31 12:53:40 02291_dictionary_scalar_subquery_reload: [ OK ] 0.27 sec.
2024-08-31 12:53:41 02287_ephemeral_format_crash: [ OK ] 0.24 sec.
2024-08-31 12:53:41 02286_tuple_numeric_identifier: [ OK ] 0.28 sec.
2024-08-31 12:53:41 02286_convert_decimal_type: [ OK ] 0.20 sec.
2024-08-31 12:53:41 02293_ttest_large_samples: [ OK ] 1.54 sec.
2024-08-31 12:53:41 02285_hex_bin_support_more_types: [ OK ] 0.27 sec.
2024-08-31 12:53:41 02275_full_sort_join_long: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:53:41 02280_add_query_level_settings: [ OK ] 0.24 sec.
2024-08-31 12:53:41 02276_full_sort_join_unsupported: [ OK ] 0.37 sec.
2024-08-31 12:53:41 02293_http_header_full_summary_without_progress: [ OK ] 2.41 sec.
2024-08-31 12:53:42 02271_temporary_table_show_rows_bytes: [ OK ] 0.19 sec.
2024-08-31 12:53:42 02293_http_header_summary_contains_exception_code_with_progress: [ OK ] 2.58 sec.
2024-08-31 12:53:42 02269_to_start_of_interval_overflow: [ OK ] 0.25 sec.
2024-08-31 12:53:42 02267_special_operator_parse_alias_check: [ OK ] 0.34 sec.
2024-08-31 12:53:43 02290_client_insert_cancel: [ OK ] 2.25 sec.
2024-08-31 12:53:43 02267_empty_arrays_read_reverse: [ OK ] 0.54 sec.
2024-08-31 12:53:43 02267_jsonlines_ndjson_format: [ OK ] 0.23 sec.
2024-08-31 12:53:43 02267_insert_empty_data: [ OK ] 0.20 sec.
2024-08-31 12:53:43 02267_type_inference_for_insert_into_function_null: [ OK ] 0.23 sec.
2024-08-31 12:53:44 02267_join_dup_columns_issue36199: [ OK ] 0.39 sec.
2024-08-31 12:53:44 02267_output_format_prometheus: [ OK ] 0.26 sec.
2024-08-31 12:53:44 02294_floating_point_second_in_settings: [ OK ] 5.22 sec.
2024-08-31 12:53:44 02266_auto_add_nullable: [ OK ] 0.22 sec.
2024-08-31 12:53:45 02274_full_sort_join_nodistinct: [ OK ] 3.48 sec.
2024-08-31 12:53:45 02265_per_table_ttl_mutation_on_change: [ OK ] 0.33 sec.
2024-08-31 12:53:45 02269_bool_map_sync_after_error: [ OK ] 3.48 sec.
2024-08-31 12:53:45 02270_errors_in_files: [ OK ] 3.73 sec.
2024-08-31 12:53:45 02260_alter_compact_part_drop_nested_column: [ OK ] 0.30 sec.
2024-08-31 12:53:45 02265_column_ttl: [ OK ] 1.03 sec.
2024-08-31 12:53:45 02267_file_globs_schema_inference: [ OK ] 2.78 sec.
2024-08-31 12:53:46 02251_alter_enum_nested_struct: [ OK ] 0.25 sec.
2024-08-31 12:53:46 02251_last_day_of_month: [ OK ] 0.26 sec.
2024-08-31 12:53:48 02317_distinct_in_order_optimization_explain: [ OK ] 11.79 sec.
2024-08-31 12:53:48 02250_lots_of_columns_in_csv_with_names: [ OK ] 2.38 sec.
2024-08-31 12:53:48 02250_ON_CLUSTER_grant: [ OK ] 2.41 sec.
2024-08-31 12:53:48 02266_protobuf_format_google_wrappers: [ OK ] 4.21 sec.
2024-08-31 12:53:48 02246_flatten_tuple: [ OK ] 0.25 sec.
2024-08-31 12:53:49 02245_s3_virtual_columns: [ OK ] 0.26 sec.
2024-08-31 12:53:49 02245_make_datetime64: [ OK ] 0.50 sec.
2024-08-31 12:53:49 02245_s3_schema_desc: [ OK ] 0.27 sec.
2024-08-31 12:53:49 02244_make_datetime: [ OK ] 0.32 sec.
2024-08-31 12:53:49 02244_ip_address_invalid_insert: [ OK ] 0.36 sec.
2024-08-31 12:53:49 02243_ipv6_long_parsing: [ OK ] 0.25 sec.
2024-08-31 12:53:50 02243_make_date32_mysql: [ OK ] 0.34 sec.
2024-08-31 12:53:50 02243_make_date32: [ OK ] 0.49 sec.
2024-08-31 12:53:50 02254_projection_broken_part: [ OK ] 4.43 sec.
2024-08-31 12:53:50 02242_case_insensitive_column_matching: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:53:50 02246_clickhouse_local_drop_database: [ OK ] 1.86 sec.
2024-08-31 12:53:50 02243_in_ip_address: [ OK ] 0.22 sec.
2024-08-31 12:53:50 02242_throw_if_constant_argument: [ OK ] 0.22 sec.
2024-08-31 12:53:50 02242_make_date_mysql: [ OK ] 0.29 sec.
2024-08-31 12:53:50 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.22 sec.
2024-08-31 12:53:50 02242_if_then_else_null_bug: [ OK ] 0.21 sec.
2024-08-31 12:53:50 02241_short_circuit_short_column: [ OK ] 0.23 sec.
2024-08-31 12:53:50 02240_asof_join_biginteger: [ OK ] 0.21 sec.
2024-08-31 12:53:50 02240_get_type_serialization_streams: [ OK ] 0.22 sec.
2024-08-31 12:53:51 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.22 sec.
2024-08-31 12:53:51 02255_broken_parts_chain_on_start: [ OK ] 5.34 sec.
2024-08-31 12:53:51 02235_check_table_sparse_serialization: [ OK ] 0.22 sec.
2024-08-31 12:53:51 02234_position_case_insensitive_utf8: [ OK ] 0.21 sec.
2024-08-31 12:53:51 02233_with_total_empty_chunk: [ OK ] 0.26 sec.
2024-08-31 12:53:51 02263_format_insert_settings: [ OK ] 6.19 sec.
2024-08-31 12:53:51 02233_interpolate_1: [ OK ] 0.44 sec.
2024-08-31 12:53:51 02233_optimize_aggregation_in_order_prefix: [ OK ] 0.28 sec.
2024-08-31 12:53:51 02235_add_part_offset_virtual_column: [ OK ] 1.06 sec.
2024-08-31 12:53:51 02232_partition_pruner_mixed_constant_type: [ OK ] 0.22 sec.
2024-08-31 12:53:52 02246_is_secure_query_log: [ OK ] 4.14 sec.
2024-08-31 12:53:52 02231_hierarchical_dictionaries_constant: [ OK ] 0.35 sec.
2024-08-31 12:53:52 02227_union_match_by_name: [ OK ] 0.22 sec.
2024-08-31 12:53:52 02226_low_cardinality_text_bloom_filter_index: [ OK ] 0.40 sec.
2024-08-31 12:53:53 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 1.55 sec.
2024-08-31 12:53:53 02233_HTTP_ranged: [ OK ] 2.02 sec.
2024-08-31 12:53:53 02241_parquet_bad_column: [ OK ] 3.19 sec.
2024-08-31 12:53:53 02224_parallel_distributed_insert_select_cluster: [ OK ] 0.39 sec.
2024-08-31 12:53:54 02223_h3_test_const_columns: [ OK ] 0.38 sec.
2024-08-31 12:53:54 02220_array_join_format: [ OK ] 0.21 sec.
2024-08-31 12:53:54 02237_lzma_bug: [ OK ] 3.39 sec.
2024-08-31 12:53:54 02227_test_create_empty_sqlite_db: [ OK ] 2.06 sec.
2024-08-31 12:53:54 02207_ttl_move_if_exists: [ OK ] 0.21 sec.
2024-08-31 12:53:54 02212_h3_get_pentagon_indexes: [ OK ] 0.29 sec.
2024-08-31 12:53:55 02225_hints_for_indeices: [ OK ] 2.44 sec.
2024-08-31 12:53:55 02221_parallel_replicas_bug: [ OK ] 2.19 sec.
2024-08-31 12:53:56 02210_processors_profile_log: [ OK ] 1.77 sec.
2024-08-31 12:53:56 02205_map_populate_series_non_const: [ OK ] 0.44 sec.
2024-08-31 12:53:56 02204_fractional_progress_bar_long: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:53:56 02205_postgresql_functions: [ OK ] 0.39 sec.
2024-08-31 12:53:56 02207_s3_content_type: [ OK ] 1.94 sec.
2024-08-31 12:53:56 02201_use_skip_indexes_if_final: [ OK ] 0.23 sec.
2024-08-31 12:53:56 02192_comment: [ OK ] 0.23 sec.
2024-08-31 12:53:56 02206_format_override: [ OK ] 2.18 sec.
2024-08-31 12:53:56 02206_clickhouse_local_use_database: [ OK ] 1.49 sec.
2024-08-31 12:53:56 02221_system_zookeeper_unrestricted_like: [ OK ] 2.94 sec.
2024-08-31 12:53:56 02189_join_type_conversion: [ OK ] 0.19 sec.
2024-08-31 12:53:56 02191_parse_date_time_best_effort_more_cases: [ OK ] 0.23 sec.
2024-08-31 12:53:57 02188_table_function_format: [ OK ] 0.23 sec.
2024-08-31 12:53:57 02187_test_final_and_limit_modifier: [ OK ] 0.23 sec.
2024-08-31 12:53:57 02185_arraySlice_negative_offset_size: [ OK ] 0.24 sec.
2024-08-31 12:53:57 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 0.30 sec.
2024-08-31 12:53:57 02184_ipv6_select_parsing: [ OK ] 0.22 sec.
2024-08-31 12:53:57 02184_ipv6_cast_test: [ OK ] 0.21 sec.
2024-08-31 12:53:57 02184_storage_add_support_ttl: [ OK ] 0.29 sec.
2024-08-31 12:53:57 02184_range_hashed_dictionary_outside_range_values: [ OK ] 0.25 sec.
2024-08-31 12:53:57 02181_dictionary_attach_detach: [ OK ] 0.28 sec.
2024-08-31 12:53:57 02183_combinator_if: [ OK ] 0.47 sec.
2024-08-31 12:53:57 02203_shebang: [ OK ] 1.47 sec.
2024-08-31 12:53:57 02183_dictionary_date_types: [ OK ] 0.45 sec.
2024-08-31 12:53:57 02181_sql_user_defined_functions_invalid_lambda: [ OK ] 0.20 sec.
2024-08-31 12:53:57 02180_group_by_lowcardinality: [ OK ] 0.21 sec.
2024-08-31 12:53:58 02179_range_hashed_dictionary_invalid_interval: [ OK ] 0.25 sec.
2024-08-31 12:53:58 02179_degrees_radians: [ OK ] 0.27 sec.
2024-08-31 12:53:58 02178_column_function_insert_from: [ OK ] 0.24 sec.
2024-08-31 12:53:58 02177_sum_if_not_found: [ OK ] 0.27 sec.
2024-08-31 12:53:58 02179_bool_type: [ OK ] 0.34 sec.
2024-08-31 12:53:58 02177_merge_optimize_aggregation_in_order: [ OK ] 0.25 sec.
2024-08-31 12:53:58 02176_optimize_aggregation_in_order_empty: [ OK ] 0.25 sec.
2024-08-31 12:53:58 02176_toStartOfWeek_overflow_pruning: [ OK ] 0.25 sec.
2024-08-31 12:53:58 02192_comment_error: [ OK ] 2.02 sec.
2024-08-31 12:53:58 02176_dict_get_has_implicit_key_cast: [ OK ] 0.39 sec.
2024-08-31 12:53:58 02165_h3_edge_length_km: [ OK ] 0.23 sec.
2024-08-31 12:53:58 02165_h3_num_hexagons: [ OK ] 0.24 sec.
2024-08-31 12:53:59 02181_format_describe_query: [ OK ] 1.62 sec.
2024-08-31 12:53:59 02161_addressToLineWithInlines: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:53:59 02163_operators: [ OK ] 0.19 sec.
2024-08-31 12:53:59 02162_array_first_last_index: [ OK ] 0.26 sec.
2024-08-31 12:53:59 02160_h3_cell_area_m2: [ OK ] 0.24 sec.
2024-08-31 12:53:59 02160_special_functions: [ OK ] 0.28 sec.
2024-08-31 12:53:59 02174_cte_scalar_cache: [ OK ] 0.80 sec.
2024-08-31 12:53:59 02160_h3_hex_area_Km2: [ OK ] 0.26 sec.
2024-08-31 12:53:59 02158_ztest: [ OK ] 0.23 sec.
2024-08-31 12:53:59 02158_proportions_ztest: [ OK ] 0.25 sec.
2024-08-31 12:54:00 02174_cte_scalar_cache_mv: [ OK ] 1.65 sec.
2024-08-31 12:54:00 02229_client_stop_multiquery_in_SIGINT: [ OK ] 8.70 sec.
2024-08-31 12:54:00 02155_dictionary_comment: [ OK ] 0.34 sec.
2024-08-31 12:54:00 02155_parse_date_lowcard_default_throw: [ OK ] 0.20 sec.
2024-08-31 12:54:00 02155_nested_lc_defalut_bug: [ OK ] 0.23 sec.
2024-08-31 12:54:01 02154_bitmap_contains: [ OK ] 0.23 sec.
2024-08-31 12:54:01 02157_readonly_system_suspend: [ OK ] 1.69 sec.
2024-08-31 12:54:01 02152_dictionary_date32_type: [ OK ] 0.26 sec.
2024-08-31 12:54:01 02158_proportions_ztest_cmp: [ OK ] 2.15 sec.
2024-08-31 12:54:01 02154_bit_slice_for_fixedstring: [ OK ] 0.68 sec.
2024-08-31 12:54:01 02151_lc_prefetch: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:54:01 02151_replace_regexp_all_empty_match_alternative: [ OK ] 0.23 sec.
2024-08-31 12:54:01 02158_ztest_cmp: [ OK ] 2.27 sec.
2024-08-31 12:54:01 02150_replace_regexp_all_empty_match: [ OK ] 0.21 sec.
2024-08-31 12:54:01 02160_client_autocomplete_parse_query: [ OK ] 2.54 sec.
2024-08-31 12:54:02 02149_issue_32487: [ OK ] 0.22 sec.
2024-08-31 12:54:02 02148_cast_type_parsing: [ OK ] 0.21 sec.
2024-08-31 12:54:02 02146_mv_non_phys: [ OK ] 0.20 sec.
2024-08-31 12:54:02 02147_order_by_optimizations: [ OK ] 0.37 sec.
2024-08-31 12:54:03 02151_client_option_echo: [ OK ] 2.17 sec.
2024-08-31 12:54:03 02142_http_with_query_parameters: [ OK ] 1.46 sec.
2024-08-31 12:54:04 02141_clickhouse_local_interactive_table: [ OK ] 1.81 sec.
2024-08-31 12:54:04 02151_http_s_structure_set_eof: [ OK ] 3.07 sec.
2024-08-31 12:54:05 02136_scalar_progress: [ OK ] 1.38 sec.
2024-08-31 12:54:05 02136_kill_scalar_queries: [ OK ] 1.94 sec.
2024-08-31 12:54:05 02133_distributed_queries_formatting: [ OK ] 0.21 sec.
2024-08-31 12:54:06 02136_scalar_read_rows_json: [ OK ] 1.71 sec.
2024-08-31 12:54:06 02133_final_prewhere_where_lowcardinality_replacing: [ OK ] 0.28 sec.
2024-08-31 12:54:06 02135_local_create_db: [ OK ] 1.67 sec.
2024-08-31 12:54:06 02149_schema_inference_formats_with_schema_3: [ OK ] 4.39 sec.
2024-08-31 12:54:06 02133_issue_32458: [ OK ] 0.25 sec.
2024-08-31 12:54:06 02131_skip_index_not_materialized: [ OK ] 0.23 sec.
2024-08-31 12:54:06 02131_row_policies_combination: [ OK ] 0.34 sec.
2024-08-31 12:54:06 02131_materialize_column_cast: [ OK ] 0.27 sec.
2024-08-31 12:54:06 02129_window_functions_disable_optimizations: [ OK ] 0.25 sec.
2024-08-31 12:54:07 02131_used_row_policies_in_query_log: [ OK ] 0.65 sec.
2024-08-31 12:54:07 02129_add_column_add_ttl: [ OK ] 0.34 sec.
2024-08-31 12:54:07 02128_apply_lambda_parsing: [ OK ] 0.23 sec.
2024-08-31 12:54:07 02128_cast_nullable: [ OK ] 0.21 sec.
2024-08-31 12:54:07 02125_dict_get_type_nullable_fix: [ OK ] 0.25 sec.
2024-08-31 12:54:07 02132_client_history_navigation: [ OK ] 1.43 sec.
2024-08-31 12:54:07 02125_fix_storage_filelog: [ OK ] 0.20 sec.
2024-08-31 12:54:09 02126_url_auth: [ OK ] 1.92 sec.
2024-08-31 12:54:09 02126_fix_filelog: [ OK ] 2.51 sec.
2024-08-31 12:54:09 02125_transform_decimal_bug: [ OK ] 0.23 sec.
2024-08-31 12:54:10 02125_constant_if_condition_and_not_existing_column: [ OK ] 0.27 sec.
2024-08-31 12:54:11 02150_index_hypothesis_race_long: [ OK ] 9.73 sec.
2024-08-31 12:54:11 02124_insert_deduplication_token: [ OK ] 0.27 sec.
2024-08-31 12:54:12 02271_replace_partition_many_tables: [ OK ] 30.45 sec.
2024-08-31 12:54:12 02124_insert_deduplication_token_materialized_views: [ OK ] 0.87 sec.
2024-08-31 12:54:12 02134_async_inserts_formats: [ OK ] 7.23 sec.
2024-08-31 12:54:12 02124_encrypt_decrypt_nullable: [ OK ] 0.26 sec.
2024-08-31 12:54:12 02124_insert_deduplication_token_replica: [ OK ] 0.37 sec.
2024-08-31 12:54:12 02125_lz4_compression_bug_Values: [ OK ] 5.25 sec.
2024-08-31 12:54:13 02125_lz4_compression_bug_CSV: [ OK ] 6.08 sec.
2024-08-31 12:54:16 02122_parallel_formatting_Markdown: [ OK ] 3.63 sec.
2024-08-31 12:54:16 02122_parallel_formatting_JSONEachRow: [ OK ] 3.78 sec.
2024-08-31 12:54:17 02122_parallel_formatting_JSONStrings: [ OK ] 4.89 sec.
2024-08-31 12:54:17 02122_parallel_formatting_JSONCompactEachRow: [ OK ] 3.88 sec.
2024-08-31 12:54:18 02125_lz4_compression_bug_TSKV: [ OK ] 8.19 sec.
2024-08-31 12:54:19 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 10.78 sec.
2024-08-31 12:54:20 02122_parallel_formatting_Values: [ OK ] 4.12 sec.
2024-08-31 12:54:21 02122_parallel_formatting_TSVWithNames: [ OK ] 3.94 sec.
2024-08-31 12:54:22 02122_parallel_formatting_PrettyCompactNoEscapes: [ OK ] 5.39 sec.
2024-08-31 12:54:22 02122_parallel_formatting_CustomSeparated: [ OK ] 3.95 sec.
2024-08-31 12:54:23 02122_parallel_formatting_JSONCompact: [ OK ] 3.75 sec.
2024-08-31 12:54:24 02122_parallel_formatting_Pretty: [ OK ] 6.22 sec.
2024-08-31 12:54:24 02124_buffer_with_type_map_long: [ OK ] 12.01 sec.
2024-08-31 12:54:25 02177_issue_31009: [ OK ] 27.03 sec.
2024-08-31 12:54:25 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 3.83 sec.
2024-08-31 12:54:26 02122_parallel_formatting_JSONCompactStrings: [ OK ] 3.99 sec.
2024-08-31 12:54:26 02122_parallel_formatting_JSONCompactStringsEachRowWithNames: [ OK ] 3.93 sec.
2024-08-31 12:54:26 02122_parallel_formatting_JSONCompactEachRowWithNamesAndTypes: [ OK ] 2.73 sec.
2024-08-31 12:54:27 02122_parallel_formatting_Vertical: [ OK ] 3.26 sec.
2024-08-31 12:54:27 02119_sumcount: [ OK ] 0.43 sec.
2024-08-31 12:54:28 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 2.57 sec.
2024-08-31 12:54:28 02122_parallel_formatting_PrettyNoEscapes: [ OK ] 4.11 sec.
2024-08-31 12:54:28 02115_map_contains: [ OK ] 0.25 sec.
2024-08-31 12:54:28 02121_pager: [ OK ] 1.81 sec.
2024-08-31 12:54:28 02116_tuple_element: [ OK ] 0.46 sec.
2024-08-31 12:54:28 02114_bool_type: [ OK ] 0.28 sec.
2024-08-31 12:54:28 02122_parallel_formatting_JSON: [ OK ] 3.18 sec.
2024-08-31 12:54:28 02113_base64encode_trailing_bytes_1: [ OK ] 0.20 sec.
2024-08-31 12:54:28 02113_format_row: [ OK ] 0.23 sec.
2024-08-31 12:54:28 02113_untuple_func_alias: [ OK ] 0.22 sec.
2024-08-31 12:54:28 02122_parallel_formatting_TSV: [ OK ] 2.64 sec.
2024-08-31 12:54:28 02112_skip_index_set_and_or: [ OK ] 0.22 sec.
2024-08-31 12:54:28 02111_global_context_temporary_tables: [ OK ] 0.25 sec.
2024-08-31 12:54:28 02111_with_fill_no_rows: [ OK ] 0.29 sec.
2024-08-31 12:54:29 02100_now64_types_bug: [ OK ] 0.24 sec.
2024-08-31 12:54:30 02112_delayed_clickhouse_local: [ OK ] 1.75 sec.
2024-08-31 12:54:30 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 1.69 sec.
2024-08-31 12:54:30 02110_clickhouse_local_custom_tld: [ OK ] 1.66 sec.
2024-08-31 12:54:30 02104_clickhouse_local_columns_description: [ OK ] 1.69 sec.
2024-08-31 12:54:30 02098_date32_comparison: [ OK ] 0.26 sec.
2024-08-31 12:54:30 02097_polygon_dictionary_store_key: [ OK ] 0.29 sec.
2024-08-31 12:54:30 02097_initializeAggregationNullable: [ OK ] 0.22 sec.
2024-08-31 12:54:30 02097_remove_sample_by: [ OK ] 0.44 sec.
2024-08-31 12:54:30 02096_date_time_1970_saturation: [ OK ] 0.31 sec.
2024-08-31 12:54:30 02096_totals_global_in_bug: [ OK ] 0.23 sec.
2024-08-31 12:54:30 02095_function_get_os_kernel_version: [ OK ] 0.22 sec.
2024-08-31 12:54:31 02071_lower_upper_utf8_row_overlaps: [ OK ] 0.27 sec.
2024-08-31 12:54:31 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.25 sec.
2024-08-31 12:54:31 02052_last_granula_adjust_logical_error: [ OK ] 0.69 sec.
2024-08-31 12:54:31 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.26 sec.
2024-08-31 12:54:32 02122_join_group_by_timeout: [ OK ] 5.84 sec.
2024-08-31 12:54:32 02050_clickhouse_local_parsing_exception: [ OK ] 1.62 sec.
2024-08-31 12:54:32 02049_clickhouse_local_merge_tree: [ OK ] 1.78 sec.
2024-08-31 12:54:33 02045_like_function: [ OK ] 0.27 sec.
2024-08-31 12:54:33 02096_bad_options_in_client_and_local: [ OK ] 3.02 sec.
2024-08-31 12:54:33 02043_user_defined_executable_function_implicit_cast: [ OK ] 0.44 sec.
2024-08-31 12:54:33 02042_map_get_non_const_key: [ OK ] 0.22 sec.
2024-08-31 12:54:34 02041_test_fuzzy_alter: [ OK ] 0.26 sec.
2024-08-31 12:54:34 02041_openssl_hash_functions_test: [ OK ] 0.23 sec.
2024-08-31 12:54:34 02039_group_by_with_totals_having: [ OK ] 0.23 sec.
2024-08-31 12:54:35 02043_query_obfuscator_embedded_dictionaries: [ OK ] 1.66 sec.
2024-08-31 12:54:35 02032_short_circuit_least_greatest_bug: [ OK ] 0.24 sec.
2024-08-31 12:54:37 02046_low_cardinality_parallel_group_by: [ OK ] 4.48 sec.
2024-08-31 12:54:37 02031_format_query_option: [ OK ] 1.74 sec.
2024-08-31 12:54:37 02047_log_family_data_file_sizes: [ OK ] 6.01 sec.
2024-08-31 12:54:38 02033_join_engine_deadlock_long: [ OK ] 3.41 sec.
2024-08-31 12:54:38 02030_function_mapContainsKeyLike: [ OK ] 0.28 sec.
2024-08-31 12:54:38 02029_quantile_sanitizer: [ OK ] 0.22 sec.
2024-08-31 12:54:38 02047_log_family_complex_structs_data_file_dumps: [ OK ] 6.14 sec.
2024-08-31 12:54:38 02027_ngrams: [ OK ] 0.32 sec.
2024-08-31 12:54:38 02026_accurate_cast_or_default: [ OK ] 0.35 sec.
2024-08-31 12:54:38 02030_client_unknown_database: [ OK ] 1.61 sec.
2024-08-31 12:54:38 02026_arrayDifference_const: [ OK ] 0.22 sec.
2024-08-31 12:54:39 02025_nested_func_for_if_combinator: [ OK ] 0.29 sec.
2024-08-31 12:54:39 02025_having_filter_column: [ OK ] 0.25 sec.
2024-08-31 12:54:39 02025_subcolumns_compact_parts: [ OK ] 0.25 sec.
2024-08-31 12:54:39 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.24 sec.
2024-08-31 12:54:39 02029_test_implemented_methods: [ OK ] 1.40 sec.
2024-08-31 12:54:39 02024_create_dictionary_with_comment: [ OK ] 0.24 sec.
2024-08-31 12:54:40 02024_join_on_or_long: [ OK ] 0.93 sec.
2024-08-31 12:54:40 02122_4letter_words_stress_zookeeper: [ OK ] 19.33 sec.
2024-08-31 12:54:40 02021_h3_is_res_classIII: [ OK ] 0.23 sec.
2024-08-31 12:54:41 02021_exponential_sum_shard: [ OK ] 0.65 sec.
2024-08-31 12:54:41 02021_prewhere_column_optimization: [ OK ] 0.21 sec.
2024-08-31 12:54:41 02021_map_bloom_filter_index: [ OK ] 0.39 sec.
2024-08-31 12:54:43 02024_compression_in_query: [ OK ] 3.67 sec.
2024-08-31 12:54:43 02020_cast_integer_overflow: [ OK ] 0.21 sec.
2024-08-31 12:54:43 02022_storage_filelog_one_file: [ OK ] 3.26 sec.
2024-08-31 12:54:43 02019_multiple_weird_with_fill: [ OK ] 0.19 sec.
2024-08-31 12:54:43 02025_storage_filelog_virtual_col: [ OK ] 4.99 sec.
2024-08-31 12:54:44 02017_columns_with_dot: [ OK ] 0.26 sec.
2024-08-31 12:54:44 02017_columns_with_dot_2: [ OK ] 0.24 sec.
2024-08-31 12:54:44 02017_bit_shift_left_for_string_integer: [ OK ] 0.55 sec.
2024-08-31 12:54:44 02023_storage_filelog: [ OK ] 4.94 sec.
2024-08-31 12:54:44 02016_agg_empty_result_bug_28880: [ OK ] 0.24 sec.
2024-08-31 12:54:44 02016_aggregation_spark_bar: [ OK ] 0.62 sec.
2024-08-31 12:54:45 02016_bit_shift_right_for_string_integer: [ OK ] 0.58 sec.
2024-08-31 12:54:45 02016_summing_mt_aggregating_column: [ OK ] 0.28 sec.
2024-08-31 12:54:45 02021_create_database_with_comment: [ OK ] 3.41 sec.
2024-08-31 12:54:45 02020_exponential_smoothing: [ OK ] 1.97 sec.
2024-08-31 12:54:45 02014_map_different_keys: [ OK ] 0.27 sec.
2024-08-31 12:54:46 02013_json_function_null_column: [ OK ] 0.40 sec.
2024-08-31 12:54:46 02013_bloom_filter_hasAll: [ OK ] 0.35 sec.
2024-08-31 12:54:47 02015_async_inserts_7: [ OK ] 2.14 sec.
2024-08-31 12:54:47 02015_async_inserts_1: [ OK ] 2.16 sec.
2024-08-31 12:54:47 02013_emptystring_cast: [ OK ] 0.30 sec.
2024-08-31 12:54:47 02012_changed_enum_type_non_replicated: [ OK ] 0.27 sec.
2024-08-31 12:54:47 02015_async_inserts_2: [ OK ] 2.28 sec.
2024-08-31 12:54:47 02012_sha512_fixedstring: [ OK ] 0.28 sec.
2024-08-31 12:54:47 02012_zookeeper_changed_enum_type: [ OK ] 0.31 sec.
2024-08-31 12:54:48 02011_normalize_utf8: [ OK ] 0.51 sec.
2024-08-31 12:54:48 02011_tuple_vector_functions: [ OK ] 0.83 sec.
2024-08-31 12:54:48 02010_array_index_bad_cast: [ OK ] 0.22 sec.
2024-08-31 12:54:49 02013_zlib_read_after_eof: [ OK ] 2.56 sec.
2024-08-31 12:54:49 02009_array_join_partition: [ OK ] 0.22 sec.
2024-08-31 12:54:49 02012_compress_lz4: [ OK ] 2.02 sec.
2024-08-31 12:54:49 02008_materialize_column: [ OK ] 0.35 sec.
2024-08-31 12:54:49 02099_tsv_raw_format: [ OK ] 20.71 sec.
2024-08-31 12:54:49 02008_test_union_distinct_in_subquery: [ OK ] 0.32 sec.
2024-08-31 12:54:49 02009_body_query_params: [ OK ] 1.39 sec.
2024-08-31 12:54:50 02007_join_use_nulls: [ OK ] 0.31 sec.
2024-08-31 12:54:50 02007_ipv4_and_ipv6_to_and_from_string: [ OK ] 0.30 sec.
2024-08-31 12:54:50 02006_use_constants_in_with_and_select: [ OK ] 0.24 sec.
2024-08-31 12:54:50 02006_todatetime64_from_string: [ OK ] 0.22 sec.
2024-08-31 12:54:50 02006_client_test_hint_error_name: [ OK ] 0.22 sec.
2024-08-31 12:54:50 02006_test_positional_arguments_on_cluster: [ OK ] 0.62 sec.
2024-08-31 12:54:50 02010_lc_native: [ OK ] 2.18 sec.
2024-08-31 12:54:50 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 0.25 sec.
2024-08-31 12:54:50 02004_intersect_except_distinct_operators: [ OK ] 0.68 sec.
2024-08-31 12:54:51 02004_max_hyperscan_regex_length: [ OK ] 0.86 sec.
2024-08-31 12:54:51 02002_sampling_and_unknown_column_bug: [ OK ] 0.24 sec.
2024-08-31 12:54:51 02000_table_function_cluster_macros: [ OK ] 0.23 sec.
2024-08-31 12:54:51 01961_roaring_memory_tracking: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:54:51 01960_lambda_precedence: [ OK ] 0.23 sec.
2024-08-31 12:54:51 01958_partial_hour_timezone: [ OK ] 0.24 sec.
2024-08-31 12:54:52 02002_system_table_with_tuple: [ OK ] 1.59 sec.
2024-08-31 12:54:52 02015_async_inserts_4: [ OK ] 7.17 sec.
2024-08-31 12:54:52 01951_distributed_push_down_limit: [ OK ] 0.22 sec.
2024-08-31 12:54:52 02003_compress_bz2: [ OK ] 1.97 sec.
2024-08-31 12:54:52 02001_append_output_file: [ OK ] 1.72 sec.
2024-08-31 12:54:53 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.24 sec.
2024-08-31 12:54:53 01947_mv_subquery: [ OK ] 0.78 sec.
2024-08-31 12:54:53 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 1.99 sec.
2024-08-31 12:54:54 01949_heredoc_unfinished: [ OK ] 1.36 sec.
2024-08-31 12:54:54 01944_insert_partition_by: [ OK ] 0.32 sec.
2024-08-31 12:54:54 01946_profile_sleep: [ OK ] 0.58 sec.
2024-08-31 12:54:54 01950_kill_large_group_by_query: [ OK ] 2.19 sec.
2024-08-31 12:54:54 01942_dateTimeToSnowflake: [ OK ] 0.34 sec.
2024-08-31 12:54:54 01943_query_id_check: [ OK ] 0.59 sec.
2024-08-31 12:54:54 01942_untuple_transformers_msan: [ OK ] 0.23 sec.
2024-08-31 12:54:55 01940_point_in_polygon_ubsan: [ OK ] 0.21 sec.
2024-08-31 12:54:55 01940_custom_tld_sharding_key: [ OK ] 0.22 sec.
2024-08-31 12:54:55 01940_totimezone_operator_monotonicity: [ OK ] 0.25 sec.
2024-08-31 12:54:55 01937_nested_chinese: [ OK ] 0.23 sec.
2024-08-31 12:54:55 01938_joins_identifiers: [ OK ] 0.26 sec.
2024-08-31 12:54:55 01932_global_in_function: [ OK ] 0.22 sec.
2024-08-31 12:54:56 01930_optimize_skip_unused_shards_rewrite_in: [ OK ] 0.63 sec.
2024-08-31 12:54:56 02003_memory_limit_in_client: [ OK ] 6.06 sec.
2024-08-31 12:54:56 01935_parametrized_query_parametric_aggregate_function: [ OK ] 1.36 sec.
2024-08-31 12:54:57 01945_show_debug_warning: [ OK ] 3.07 sec.
2024-08-31 12:54:57 01926_union_all_schmak: [ OK ] 0.20 sec.
2024-08-31 12:54:57 01927_query_views_log_current_database: [ OK ] 0.70 sec.
2024-08-31 12:54:57 01939_network_receive_bytes_metrics: [ OK ] 2.17 sec.
2024-08-31 12:54:57 01926_date_date_time_supertype: [ OK ] 0.30 sec.
2024-08-31 12:54:57 01926_bin_unbin: [ OK ] 0.37 sec.
2024-08-31 12:54:57 01925_merge_prewhere_table: [ OK ] 0.28 sec.
2024-08-31 12:54:57 01925_json_as_string_data_in_square_brackets: [ OK ] 0.24 sec.
2024-08-31 12:54:57 01925_date_date_time_comparison: [ OK ] 0.20 sec.
2024-08-31 12:54:57 01925_map_populate_series_on_map: [ OK ] 0.46 sec.
2024-08-31 12:54:57 01925_jit_aggregation_function_count_long: [ OK ] 0.35 sec.
2024-08-31 12:54:58 01923_ttl_with_modify_column: [ OK ] 0.34 sec.
2024-08-31 12:54:58 01923_different_expression_name_alias: [ OK ] 0.26 sec.
2024-08-31 12:54:58 01922_sum_null_for_remote: [ OK ] 0.26 sec.
2024-08-31 12:54:58 01922_array_join_with_index: [ OK ] 0.25 sec.
2024-08-31 12:54:58 01921_with_fill_with_totals: [ OK ] 0.24 sec.
2024-08-31 12:54:58 01926_order_by_desc_limit: [ OK ] 1.71 sec.
2024-08-31 12:54:58 01917_prewhere_column_type: [ OK ] 0.33 sec.
2024-08-31 12:54:58 01921_test_progress_bar: [ OK ] 0.55 sec.
2024-08-31 12:54:59 01921_datatype_date32: [ OK ] 0.82 sec.
2024-08-31 12:54:59 01915_merge_prewhere_virtual_column_rand_chao_wang: [ OK ] 0.30 sec.
2024-08-31 12:54:59 01917_system_data_skipping_indices: [ OK ] 0.32 sec.
2024-08-31 12:54:59 01915_json_extract_raw_string: [ OK ] 0.21 sec.
2024-08-31 12:54:59 02030_rocksdb_race_long: [ OK ] 21.89 sec.
2024-08-31 12:54:59 01914_ubsan_quantile_timing: [ OK ] 0.24 sec.
2024-08-31 12:54:59 01913_names_of_tuple_literal: [ OK ] 0.24 sec.
2024-08-31 12:54:59 01913_fix_column_transformer_replace_format: [ OK ] 0.23 sec.
2024-08-31 12:54:59 01914_index_bgranvea: [ OK ] 0.26 sec.
2024-08-31 12:54:59 01906_partition_by_multiply_by_zero: [ OK ] 0.23 sec.
2024-08-31 12:54:59 01902_table_function_merge_db_params: [ OK ] 0.32 sec.
2024-08-31 12:54:59 01906_bigint_accurate_cast_ubsan: [ OK ] 0.38 sec.
2024-08-31 12:54:59 01901_in_literal_shard_prune: [ OK ] 0.23 sec.
2024-08-31 12:55:00 01892_setting_limit_offset_distributed: [ OK ] 0.32 sec.
2024-08-31 12:55:00 01891_partition_by_uuid: [ OK ] 0.22 sec.
2024-08-31 12:55:00 01893_jit_aggregation_function_min_long: [ OK ] 0.79 sec.
2024-08-31 12:55:00 01894_jit_aggregation_function_max_long: [ OK ] 0.82 sec.
2024-08-31 12:55:00 01891_partition_hash_no_long_int: [ OK ] 0.25 sec.
2024-08-31 12:55:00 01891_not_like_partition_prune: [ OK ] 0.28 sec.
2024-08-31 12:55:01 01927_query_views_log_matview_exceptions: [ OK ] 4.44 sec.
2024-08-31 12:55:01 01890_state_of_state: [ OK ] 0.40 sec.
2024-08-31 12:55:01 01903_http_fields: [ OK ] 1.86 sec.
2024-08-31 12:55:01 01890_jit_aggregation_function_sum_long: [ OK ] 0.90 sec.
2024-08-31 12:55:01 02100_multiple_hosts_command_line_set_ssl: [ OK ] 32.64 sec.
2024-08-31 12:55:01 01882_scalar_subquery_exception: [ OK ] 0.37 sec.
2024-08-31 12:55:01 01881_create_as_tuple: [ OK ] 0.29 sec.
2024-08-31 12:55:01 01882_check_max_parts_to_merge_at_once: [ OK ] 0.72 sec.
2024-08-31 12:55:01 01881_to_week_monotonic_fix: [ OK ] 0.27 sec.
2024-08-31 12:55:02 01880_materialized_view_to_table_type_check: [ OK ] 0.35 sec.
2024-08-31 12:55:02 01954_clickhouse_benchmark_multiple_long: [ OK ] 9.99 sec.
2024-08-31 12:55:02 01880_remote_ipv6: [ OK ] 0.51 sec.
2024-08-31 12:55:02 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.20 sec.
2024-08-31 12:55:02 01872_functions_to_subcolumns: [ OK ] 0.29 sec.
2024-08-31 12:55:02 01868_order_by_fill_with_datetime64: [ OK ] 0.24 sec.
2024-08-31 12:55:02 01871_merge_tree_compile_expressions: [ OK ] 0.50 sec.
2024-08-31 12:55:02 01881_join_on_conditions_merge: [ OK ] 1.22 sec.
2024-08-31 12:55:02 01881_join_on_conditions_hash: [ OK ] 1.05 sec.
2024-08-31 12:55:02 01866_datetime64_cmp_with_constant: [ OK ] 0.29 sec.
2024-08-31 12:55:03 01866_bit_positions_to_array: [ OK ] 0.32 sec.
2024-08-31 12:55:03 01865_aggregator_overflow_row: [ OK ] 0.31 sec.
2024-08-31 12:55:03 01853_s2_cells_intersect: [ OK ] 0.25 sec.
2024-08-31 12:55:03 01882_total_rows_approx: [ OK ] 2.14 sec.
2024-08-31 12:55:03 01866_view_persist_settings: [ OK ] 0.44 sec.
2024-08-31 12:55:03 01852_s2_get_neighbours: [ OK ] 0.22 sec.
2024-08-31 12:55:03 01851_array_difference_decimal_overflow_ubsan: [ OK ] 0.24 sec.
2024-08-31 12:55:03 01851_s2_to_geo: [ OK ] 0.21 sec.
2024-08-31 12:55:03 01851_hedged_connections_external_tables: [ OK ] 0.27 sec.
2024-08-31 12:55:03 01889_clickhouse_client_config_format: [ OK ] 2.71 sec.
2024-08-31 12:55:03 01851_clear_column_referenced_by_mv: [ OK ] 0.25 sec.
2024-08-31 12:55:03 01846_alter_column_without_type_bugfix: [ OK ] 0.22 sec.
2024-08-31 12:55:03 01848_partition_value_column: [ OK ] 0.31 sec.
2024-08-31 12:55:03 01845_add_testcase_for_arrayElement: [ OK ] 0.26 sec.
2024-08-31 12:55:03 01839_join_to_subqueries_rewriter_columns_matcher: [ OK ] 0.20 sec.
2024-08-31 12:55:03 01849_geoToS2: [ OK ] 0.43 sec.
2024-08-31 12:55:03 01838_system_dictionaries_virtual_key_column: [ OK ] 0.24 sec.
2024-08-31 12:55:03 01837_cast_to_array_from_empty_array: [ OK ] 0.23 sec.
2024-08-31 12:55:04 01835_alias_to_primary_key_cyfdecyf: [ OK ] 0.24 sec.
2024-08-31 12:55:04 01832_memory_write_suffix: [ OK ] 0.24 sec.
2024-08-31 12:55:04 01831_max_streams: [ OK ] 0.24 sec.
2024-08-31 12:55:04 01825_type_json_mutations: [ OK ] 0.28 sec.
2024-08-31 12:55:04 01825_type_json_5: [ OK ] 0.25 sec.
2024-08-31 12:55:04 01854_HTTP_dict_decompression: [ OK ] 1.75 sec.
2024-08-31 12:55:04 01852_hints_enum_name: [ OK ] 1.60 sec.
2024-08-31 12:55:04 01825_type_json_in_array: [ OK ] 0.30 sec.
2024-08-31 12:55:05 01825_type_json_2: [ OK ] 0.36 sec.
2024-08-31 12:55:05 01825_type_json_3: [ OK ] 0.43 sec.
2024-08-31 12:55:05 01834_alias_columns_laziness_filimonov: [ OK ] 2.07 sec.
2024-08-31 12:55:07 01825_type_json_13: [ OK ] 2.75 sec.
2024-08-31 12:55:07 01825_type_json_8: [ OK ] 3.05 sec.
2024-08-31 12:55:07 01825_type_json_missed_values: [ OK ] 0.29 sec.
2024-08-31 12:55:07 01825_type_json_from_map: [ OK ] 3.09 sec.
2024-08-31 12:55:07 01825_type_json_in_other_types: [ OK ] 3.46 sec.
2024-08-31 12:55:07 01825_type_json_ephemeral: [ OK ] 0.23 sec.
2024-08-31 12:55:07 01825_type_json_partitions: [ OK ] 0.24 sec.
2024-08-31 12:55:07 01825_type_json_15: [ OK ] 2.72 sec.
2024-08-31 12:55:07 01825_type_json_empty_string: [ OK ] 0.22 sec.
2024-08-31 12:55:07 01825_type_json_field: [ OK ] 0.28 sec.
2024-08-31 12:55:09 01825_type_json_7: [ OK ] 2.46 sec.
2024-08-31 12:55:09 01825_type_json_18: [ OK ] 0.23 sec.
2024-08-31 12:55:10 01825_type_json_1: [ OK ] 0.37 sec.
2024-08-31 12:55:10 01825_type_json_nbagames: [ OK ] 5.07 sec.
2024-08-31 12:55:10 01825_type_json_16: [ OK ] 2.72 sec.
2024-08-31 12:55:10 01822_union_and_constans_error: [ OK ] 0.22 sec.
2024-08-31 12:55:10 01821_to_date_time_ubsan: [ OK ] 0.23 sec.
2024-08-31 12:55:10 01821_join_table_mutation: [ OK ] 0.29 sec.
2024-08-31 12:55:10 01825_type_json_4: [ OK ] 3.04 sec.
2024-08-31 12:55:10 01825_type_json_schema_inference: [ OK ] 3.45 sec.
2024-08-31 12:55:11 01822_short_circuit: [ OK ] 0.62 sec.
2024-08-31 12:55:11 01818_case_float_value_fangyc: [ OK ] 0.22 sec.
2024-08-31 12:55:11 01817_storage_buffer_parameters: [ OK ] 0.22 sec.
2024-08-31 12:55:11 01818_move_partition_simple: [ OK ] 0.30 sec.
2024-08-31 12:55:11 01813_quantileBfloat16_nans: [ OK ] 0.23 sec.
2024-08-31 12:55:11 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.21 sec.
2024-08-31 12:55:11 01812_has_generic: [ OK ] 0.21 sec.
2024-08-31 12:55:11 01804_uniq_up_to_ubsan: [ OK ] 0.21 sec.
2024-08-31 12:55:11 01802_formatDateTime_DateTime64_century: [ OK ] 0.21 sec.
2024-08-31 12:55:11 01802_toDateTime64_large_values: [ OK ] 0.22 sec.
2024-08-31 12:55:11 01802_rank_corr_mann_whitney_over_window: [ OK ] 0.25 sec.
2024-08-31 12:55:11 01825_type_json_ghdata: [ OK ] 5.74 sec.
2024-08-31 12:55:11 01801_s3_cluster_count: [ OK ] 0.31 sec.
2024-08-31 12:55:11 01798_having_push_down: [ OK ] 0.22 sec.
2024-08-31 12:55:11 01797_StripeLog_rwlock_ub: [ OK ] 0.24 sec.
2024-08-31 12:55:11 01795_TinyLog_rwlock_ub: [ OK ] 0.22 sec.
2024-08-31 12:55:11 01796_Log_rwlock_ub: [ OK ] 0.23 sec.
2024-08-31 12:55:12 01798_uniq_theta_sketch: [ OK ] 0.72 sec.
2024-08-31 12:55:12 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 0.26 sec.
2024-08-31 12:55:12 01787_arena_assert_column_nothing: [ OK ] 0.19 sec.
2024-08-31 12:55:12 01788_update_nested_type_subcolumn_check: [ OK ] 0.47 sec.
2024-08-31 12:55:12 01787_map_remote: [ OK ] 0.25 sec.
2024-08-31 12:55:12 01785_pmj_lc_bug: [ OK ] 0.24 sec.
2024-08-31 12:55:12 01786_group_by_pk_many_streams: [ OK ] 0.38 sec.
2024-08-31 12:55:13 01784_parallel_formatting_memory: [ OK ] 0.36 sec.
2024-08-31 12:55:13 01791_dist_INSERT_block_structure_mismatch: [ OK ] 1.45 sec.
2024-08-31 12:55:13 01783_merge_engine_join_key_condition: [ OK ] 0.29 sec.
2024-08-31 12:55:13 01781_token_extractor_buffer_overflow: [ OK ] 0.39 sec.
2024-08-31 12:55:13 01799_long_uniq_theta_sketch: [ OK ] 2.39 sec.
2024-08-31 12:55:14 01783_parallel_formatting_memory: [ OK ] 1.51 sec.
2024-08-31 12:55:14 01782_field_oom: [ OK ] 1.05 sec.
2024-08-31 12:55:14 01811_storage_buffer_flush_parameters: [ OK ] 3.23 sec.
2024-08-31 12:55:14 01781_merge_tree_deduplication: [ OK ] 0.76 sec.
2024-08-31 12:55:14 01785_parallel_formatting_memory: [ OK ] 2.05 sec.
2024-08-31 12:55:14 01780_column_sparse_distinct: [ OK ] 0.24 sec.
2024-08-31 12:55:14 01780_column_sparse_full: [ OK ] 0.75 sec.
2024-08-31 12:55:14 01780_range_msan: [ OK ] 0.21 sec.
2024-08-31 12:55:14 01825_type_json_ghdata_insert_select: [ OK ] 6.82 sec.
2024-08-31 12:55:14 01780_column_sparse_filter: [ OK ] 0.29 sec.
2024-08-31 12:55:14 01778_where_with_column_name: [ OK ] 0.23 sec.
2024-08-31 12:55:14 01774_tuple_null_in: [ OK ] 0.20 sec.
2024-08-31 12:55:14 01776_decrypt_aead_size_check: [ OK ] 0.22 sec.
2024-08-31 12:55:14 01780_column_sparse_tuple: [ OK ] 0.30 sec.
2024-08-31 12:55:14 01774_bar_with_illegal_value: [ OK ] 0.22 sec.
2024-08-31 12:55:14 01780_column_sparse_pk: [ OK ] 0.33 sec.
2024-08-31 12:55:14 01774_case_sensitive_connection_id: [ OK ] 0.19 sec.
2024-08-31 12:55:15 01773_datetime64_add_ubsan: [ OK ] 0.22 sec.
2024-08-31 12:55:15 01773_min_max_time_system_parts_datetime64: [ OK ] 0.22 sec.
2024-08-31 12:55:15 01770_add_months_ubsan: [ OK ] 0.20 sec.
2024-08-31 12:55:15 01771_datetime64_no_time_part: [ OK ] 0.22 sec.
2024-08-31 12:55:15 01770_extended_range_3: [ OK ] 0.25 sec.
2024-08-31 12:55:15 01772_to_start_of_hour_align: [ OK ] 0.30 sec.
2024-08-31 12:55:15 01769_extended_range_2: [ OK ] 0.26 sec.
2024-08-31 12:55:15 01768_extended_range: [ OK ] 0.22 sec.
2024-08-31 12:55:15 01766_todatetime64_no_timezone_arg: [ OK ] 0.23 sec.
2024-08-31 12:55:15 01761_cast_to_enum_nullable: [ OK ] 0.22 sec.
2024-08-31 12:55:15 01762_deltasumtimestamp: [ OK ] 0.27 sec.
2024-08-31 12:55:15 01755_shard_pruning_with_literal: [ OK ] 0.25 sec.
2024-08-31 12:55:15 01753_mutate_table_predicated_with_table: [ OK ] 0.24 sec.
2024-08-31 12:55:15 01748_partition_id_pruning: [ OK ] 0.28 sec.
2024-08-31 12:55:15 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 0.37 sec.
2024-08-31 12:55:15 01746_extract_text_from_html: [ OK ] 0.32 sec.
2024-08-31 12:55:15 01763_long_ttl_group_by: [ OK ] 0.74 sec.
2024-08-31 12:55:16 01746_test_for_tupleElement_must_be_constant_issue: [ OK ] 0.41 sec.
2024-08-31 12:55:16 01739_index_hint: [ OK ] 0.35 sec.
2024-08-31 12:55:16 01746_forbid_drop_column_referenced_by_mv: [ OK ] 0.42 sec.
2024-08-31 12:55:16 01736_null_as_default: [ OK ] 0.24 sec.
2024-08-31 12:55:16 01732_union_and_union_all: [ OK ] 0.22 sec.
2024-08-31 12:55:16 01767_timezoneOf: [ OK ] 1.52 sec.
2024-08-31 12:55:16 01720_engine_file_empty_if_not_exists: [ OK ] 0.23 sec.
2024-08-31 12:55:16 01753_optimize_aggregation_in_order: [ OK ] 1.53 sec.
2024-08-31 12:55:16 01720_union_distinct_with_limit: [ OK ] 0.21 sec.
2024-08-31 12:55:16 01750_parsing_exception: [ OK ] 1.60 sec.
2024-08-31 12:55:17 01719_join_timezone: [ OK ] 0.28 sec.
2024-08-31 12:55:17 01716_drop_rename_sign_column: [ OK ] 0.25 sec.
2024-08-31 12:55:17 01746_long_zlib_http_compression_json_format: [ OK ] 1.60 sec.
2024-08-31 12:55:17 01715_table_function_view_fix: [ OK ] 0.21 sec.
2024-08-31 12:55:17 01714_alter_drop_version: [ OK ] 0.27 sec.
2024-08-31 12:55:17 01710_projection_in_set: [ OK ] 0.36 sec.
2024-08-31 12:55:17 01710_projection_row_policy: [ OK ] 0.24 sec.
2024-08-31 12:55:18 01710_minmax_count_projection_constant_query: [ OK ] 0.21 sec.
2024-08-31 12:55:18 01720_join_implicit_cast: [ OK ] 1.75 sec.
2024-08-31 12:55:18 01710_minmax_count_projection_modify_partition_key: [ OK ] 0.23 sec.
2024-08-31 12:55:18 01710_normal_projection_with_query_plan_optimization: [ OK ] 0.29 sec.
2024-08-31 12:55:18 01710_projection_external_aggregate: [ OK ] 0.33 sec.
2024-08-31 12:55:18 01710_projection_optimize_group_by_function_keys: [ OK ] 0.21 sec.
2024-08-31 12:55:19 01710_projection_group_by_order_by: [ OK ] 0.18 sec.
2024-08-31 12:55:19 01710_projection_with_ast_rewrite_settings: [ OK ] 0.28 sec.
2024-08-31 12:55:19 01710_projection_with_column_transformers: [ OK ] 0.21 sec.
2024-08-31 12:55:19 01710_projection_detach_part: [ OK ] 0.23 sec.
2024-08-31 12:55:19 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.21 sec.
2024-08-31 12:55:19 01710_projection_with_mixed_pipeline: [ OK ] 0.23 sec.
2024-08-31 12:55:19 01710_projections_order_by_complete: [ OK ] 0.23 sec.
2024-08-31 12:55:19 01710_normal_projection_format: [ OK ] 0.19 sec.
2024-08-31 12:55:19 01731_async_task_queue_wait: [ OK ] 3.57 sec.
2024-08-31 12:55:20 01710_query_log_with_projection_info: [ OK ] 0.63 sec.
2024-08-31 12:55:20 01710_force_use_projection: [ OK ] 0.27 sec.
2024-08-31 12:55:20 01721_join_implicit_cast_long: [ OK ] 4.50 sec.
2024-08-31 12:55:20 01710_projections_and_duplicate_columms: [ OK ] 0.31 sec.
2024-08-31 12:55:21 01710_minmax_count_projection_distributed_query: [ OK ] 0.27 sec.
2024-08-31 12:55:21 01720_country_perimeter_and_area: [ OK ] 4.30 sec.
2024-08-31 12:55:21 01710_projection_drop_if_exists: [ OK ] 0.23 sec.
2024-08-31 12:55:21 01710_projections_group_by_no_key: [ OK ] 0.23 sec.
2024-08-31 12:55:21 01710_normal_projection_join_plan_fix: [ OK ] 0.25 sec.
2024-08-31 12:55:21 01710_aggregate_projection_with_monotonic_key_expr: [ OK ] 0.24 sec.
2024-08-31 12:55:21 01710_order_by_projections_incomplete: [ OK ] 0.24 sec.
2024-08-31 12:55:21 01710_projection_array_join: [ OK ] 0.21 sec.
2024-08-31 12:55:21 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.21 sec.
2024-08-31 12:55:21 01710_projection_with_nullable_keys: [ OK ] 0.23 sec.
2024-08-31 12:55:21 01710_projection_optimize_materialize: [ OK ] 0.47 sec.
2024-08-31 12:55:22 01702_toDateTime_from_string_clamping: [ OK ] 0.20 sec.
2024-08-31 12:55:22 01702_system_numbers_scientific_notation: [ OK ] 0.28 sec.
2024-08-31 12:55:22 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 0.27 sec.
2024-08-31 12:55:22 01700_point_in_polygon_ubsan: [ OK ] 0.21 sec.
2024-08-31 12:55:22 01701_clear_projection_and_part_remove: [ OK ] 0.29 sec.
2024-08-31 12:55:22 01700_mod_negative_type_promotion: [ OK ] 0.24 sec.
2024-08-31 12:55:22 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 4.83 sec.
2024-08-31 12:55:22 01700_system_zookeeper_path_in: [ OK ] 0.29 sec.
2024-08-31 12:55:22 01691_DateTime64_clamp: [ OK ] 0.26 sec.
2024-08-31 12:55:22 01699_timezoneOffset: [ OK ] 0.34 sec.
2024-08-31 12:55:22 01690_quantilesTiming_ubsan: [ OK ] 0.22 sec.
2024-08-31 12:55:22 01685_json_extract_double_as_float: [ OK ] 0.22 sec.
2024-08-31 12:55:23 01686_rocksdb: [ OK ] 0.34 sec.
2024-08-31 12:55:23 01683_intdiv_ubsan: [ OK ] 0.22 sec.
2024-08-31 12:55:23 01684_insert_specify_shard_id: [ OK ] 0.35 sec.
2024-08-31 12:55:23 01683_dist_INSERT_block_structure_mismatch: [ OK ] 0.24 sec.
2024-08-31 12:55:23 01682_gather_utils_ubsan: [ OK ] 0.22 sec.
2024-08-31 12:55:23 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.21 sec.
2024-08-31 12:55:23 01681_bloom_filter_nullable_column: [ OK ] 0.37 sec.
2024-08-31 12:55:23 01910_view_dictionary_check_refresh: [ OK ] 24.33 sec.
2024-08-31 12:55:23 01678_great_circle_angle: [ OK ] 0.24 sec.
2024-08-31 12:55:23 01680_date_time_add_ubsan: [ OK ] 0.31 sec.
2024-08-31 12:55:24 01710_projections_optimize_aggregation_in_order: [ OK ] 4.45 sec.
2024-08-31 12:55:24 01674_unicode_asan: [ OK ] 0.30 sec.
2024-08-31 12:55:24 01673_test_toMinute_mysql_dialect: [ OK ] 0.22 sec.
2024-08-31 12:55:24 01671_aggregate_function_group_bitmap_data: [ OK ] 0.27 sec.
2024-08-31 12:55:24 01670_distributed_bytes_to_throw_insert: [ OK ] 0.27 sec.
2024-08-31 12:55:24 01670_test_repeat_mysql_dialect: [ OK ] 0.19 sec.
2024-08-31 12:55:24 01681_hyperscan_debug_assertion: [ OK ] 1.62 sec.
2024-08-31 12:55:25 01670_log_comment: [ OK ] 0.46 sec.
2024-08-31 12:55:25 01669_test_toYear_mysql_dialect: [ OK ] 0.21 sec.
2024-08-31 12:55:25 01668_avg_weighted_ubsan: [ OK ] 0.24 sec.
2024-08-31 12:55:25 01667_aes_args_check: [ OK ] 0.22 sec.
2024-08-31 12:55:25 01710_normal_projections: [ OK ] 5.47 sec.
2024-08-31 12:55:25 01666_date_lut_buffer_overflow: [ OK ] 0.21 sec.
2024-08-31 12:55:25 01666_gcd_ubsan: [ OK ] 0.38 sec.
2024-08-31 12:55:25 01674_clickhouse_client_query_param_cte: [ OK ] 1.66 sec.
2024-08-31 12:55:25 01666_lcm_ubsan: [ OK ] 0.33 sec.
2024-08-31 12:55:25 01665_substring_ubsan: [ OK ] 0.23 sec.
2024-08-31 12:55:25 01664_array_slice_ubsan: [ OK ] 0.20 sec.
2024-08-31 12:55:25 01691_parser_data_type_exponential: [ OK ] 3.11 sec.
2024-08-31 12:55:25 01664_decimal_ubsan: [ OK ] 0.21 sec.
2024-08-31 12:55:25 01663_test_toDate_mysql_compatibility: [ OK ] 0.21 sec.
2024-08-31 12:55:25 01663_quantile_weighted_overflow: [ OK ] 0.21 sec.
2024-08-31 12:55:25 01663_aes_msan: [ OK ] 0.21 sec.
2024-08-31 12:55:25 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.20 sec.
2024-08-31 12:55:25 01662_join_mixed: [ OK ] 0.21 sec.
2024-08-31 12:55:26 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.20 sec.
2024-08-31 12:55:26 01660_second_extremes_bug: [ OK ] 0.22 sec.
2024-08-31 12:55:26 01660_join_or_inner: [ OK ] 0.28 sec.
2024-08-31 12:55:26 01659_test_base64Decode_mysql_compatibility: [ OK ] 0.19 sec.
2024-08-31 12:55:26 01660_join_or_all: [ OK ] 0.49 sec.
2024-08-31 12:55:26 01661_week_functions_string_args: [ OK ] 0.57 sec.
2024-08-31 12:55:26 01662_date_ubsan: [ OK ] 0.65 sec.
2024-08-31 12:55:26 01658_values_ubsan: [ OK ] 0.21 sec.
2024-08-31 12:55:26 01657_array_element_ubsan: [ OK ] 0.22 sec.
2024-08-31 12:55:26 01657_test_toHour_mysql_compatibility: [ OK ] 0.21 sec.
2024-08-31 12:55:26 01656_ipv4_bad_formatting: [ OK ] 0.20 sec.
2024-08-31 12:55:26 01655_test_isnull_mysql_dialect: [ OK ] 0.20 sec.
2024-08-31 12:55:26 01655_sleep_infinite_float: [ OK ] 0.18 sec.
2024-08-31 12:55:26 01655_agg_if_nullable: [ OK ] 0.21 sec.
2024-08-31 12:55:27 01655_window_functions_bug: [ OK ] 0.22 sec.
2024-08-31 12:55:27 01655_quarter_modificator_for_formatDateTime: [ OK ] 0.22 sec.
2024-08-31 12:55:27 01652_ttl_old_syntax: [ OK ] 0.22 sec.
2024-08-31 12:55:27 01651_group_uniq_array_enum: [ OK ] 0.24 sec.
2024-08-31 12:55:27 01715_background_checker_blather_zookeeper_long: [ OK ] 10.33 sec.
2024-08-31 12:55:27 01650_expressions_merge_bug: [ OK ] 0.21 sec.
2024-08-31 12:55:27 01651_map_functions: [ OK ] 0.51 sec.
2024-08-31 12:55:27 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 0.30 sec.
2024-08-31 12:55:28 01646_fix_window_funnel_inconistency: [ OK ] 0.29 sec.
2024-08-31 12:55:28 01646_rewrite_sum_if: [ OK ] 0.38 sec.
2024-08-31 12:55:28 01640_distributed_async_insert_compression: [ OK ] 0.25 sec.
2024-08-31 12:55:28 01641_memory_tracking_insert_optimize: [ OK ] 0.50 sec.
2024-08-31 12:55:28 01656_sequence_next_node_long: [ OK ] 2.14 sec.
2024-08-31 12:55:28 01634_summap_nullable: [ OK ] 0.22 sec.
2024-08-31 12:55:28 01634_sum_map_nulls: [ OK ] 0.24 sec.
2024-08-31 12:55:28 01633_limit_fuzz: [ OK ] 0.22 sec.
2024-08-31 12:55:29 01632_nullable_string_type_convert_to_decimal_type: [ OK ] 0.21 sec.
2024-08-31 12:55:29 01632_max_partitions_to_read: [ OK ] 0.26 sec.
2024-08-31 12:55:29 01675_distributed_bytes_to_delay_insert: [ OK ] 5.63 sec.
2024-08-31 12:55:29 01631_date_overflow_as_partition_key: [ OK ] 0.25 sec.
2024-08-31 12:55:29 01630_simple_aggregate_function_in_summing_merge_tree: [ OK ] 0.29 sec.
2024-08-31 12:55:29 01626_cnf_test: [ OK ] 0.24 sec.
2024-08-31 12:55:29 01623_byte_size_const: [ OK ] 0.21 sec.
2024-08-31 12:55:29 01622_constraints_where_optimization: [ OK ] 0.26 sec.
2024-08-31 12:55:29 01666_merge_tree_max_query_limit: [ OK ] 4.74 sec.
2024-08-31 12:55:30 01621_sort_after_join_pipeline_stuck: [ OK ] 0.29 sec.
2024-08-31 12:55:30 01621_summap_check_types: [ OK ] 0.25 sec.
2024-08-31 12:55:30 01621_bar_nan_arguments: [ OK ] 0.24 sec.
2024-08-31 12:55:30 01622_constraints_simple_optimization: [ OK ] 0.80 sec.
2024-08-31 12:55:30 01616_untuple_access_field: [ OK ] 0.43 sec.
2024-08-31 12:55:30 01620_fix_simple_state_arg_type: [ OK ] 0.52 sec.
2024-08-31 12:55:31 01614_with_fill_with_limit: [ OK ] 0.25 sec.
2024-08-31 12:55:31 01615_two_args_function_index_fix: [ OK ] 0.37 sec.
2024-08-31 12:55:31 01610_client_spawn_editor: [ OK ] 0.25 sec.
2024-08-31 12:55:31 01611_string_to_low_cardinality_key_alter: [ OK ] 0.42 sec.
2024-08-31 12:55:31 01622_defaults_for_url_engine: [ OK ] 2.05 sec.
2024-08-31 12:55:31 01605_key_condition_enum_int: [ OK ] 0.35 sec.
2024-08-31 12:55:31 01605_skip_idx_compact_parts: [ OK ] 0.29 sec.
2024-08-31 12:55:32 01604_explain_ast_of_nonselect_query: [ OK ] 0.22 sec.
2024-08-31 12:55:32 01605_drop_settings_profile_while_assigned: [ OK ] 0.26 sec.
2024-08-31 12:55:32 01603_decimal_mult_float: [ OK ] 0.39 sec.
2024-08-31 12:55:32 01648_mutations_and_escaping: [ OK ] 4.97 sec.
2024-08-31 12:55:33 01603_remove_column_ttl: [ OK ] 0.42 sec.
2024-08-31 12:55:33 01621_clickhouse_compressor: [ OK ] 2.93 sec.
2024-08-31 12:55:33 01602_runningConcurrency: [ OK ] 0.56 sec.
2024-08-31 12:55:33 01602_modified_julian_day_msan: [ OK ] 0.37 sec.
2024-08-31 12:55:33 01600_encode_XML: [ OK ] 0.28 sec.
2024-08-31 12:55:34 01600_min_max_compress_block_size: [ OK ] 0.26 sec.
2024-08-31 12:55:34 01607_arrays_as_nested_csv: [ OK ] 3.30 sec.
2024-08-31 12:55:35 01601_proxy_protocol: [ OK ] 2.18 sec.
2024-08-31 12:55:35 01600_quota_by_forwarded_ip: [ OK ] 2.49 sec.
2024-08-31 12:55:35 01596_setting_limit_offset: [ OK ] 0.39 sec.
2024-08-31 12:55:35 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 1.70 sec.
2024-08-31 12:55:36 01592_length_map: [ OK ] 0.25 sec.
2024-08-31 12:55:36 01599_multiline_input_and_singleline_comments: [ OK ] 1.34 sec.
2024-08-31 12:55:36 01595_countMatches: [ OK ] 0.50 sec.
2024-08-31 12:55:36 01593_insert_settings: [ OK ] 0.59 sec.
2024-08-31 12:55:36 01592_toUnixTimestamp_Date: [ OK ] 0.30 sec.
2024-08-31 12:55:36 01585_use_index_for_global_in: [ OK ] 0.40 sec.
2024-08-31 12:55:36 01585_fuzz_bits_with_bugfix: [ OK ] 0.29 sec.
2024-08-31 12:55:37 01586_columns_pruning: [ OK ] 0.98 sec.
2024-08-31 12:55:37 01582_distinct_subquery_groupby: [ OK ] 0.57 sec.
2024-08-31 12:55:37 01581_deduplicate_by_columns_replicated_long: [ OK ] 0.91 sec.
2024-08-31 12:55:37 01580_column_const_comparision: [ OK ] 0.39 sec.
2024-08-31 12:55:38 01581_deduplicate_by_columns_local: [ OK ] 0.96 sec.
2024-08-31 12:55:38 01576_alias_column_rewrite: [ OK ] 0.62 sec.
2024-08-31 12:55:38 01567_system_processes_current_database: [ OK ] 0.26 sec.
2024-08-31 12:55:38 01603_read_with_backoff_bug: [ OK ] 6.60 sec.
2024-08-31 12:55:38 01562_optimize_monotonous_functions_in_order_by: [ OK ] 0.29 sec.
2024-08-31 12:55:39 01561_aggregate_functions_of_key_with_join: [ OK ] 0.22 sec.
2024-08-31 12:55:39 01562_agg_null_for_empty_ahead: [ OK ] 0.41 sec.
2024-08-31 12:55:39 01655_plan_optimizations: [ OK ] 12.59 sec.
2024-08-31 12:55:39 01560_DateTime_and_DateTime64_comparision: [ OK ] 0.24 sec.
2024-08-31 12:55:39 01560_optimize_on_insert_zookeeper: [ OK ] 0.52 sec.
2024-08-31 12:55:39 01559_aggregate_null_for_empty_fix: [ OK ] 0.36 sec.
2024-08-31 12:55:40 01558_transform_null_in: [ OK ] 0.36 sec.
2024-08-31 12:55:40 01560_crash_in_agg_empty_arglist: [ OK ] 0.73 sec.
2024-08-31 12:55:40 01576_if_null_external_aggregation: [ OK ] 1.91 sec.
2024-08-31 12:55:40 01558_enum_as_num_in_tsv_csv_input: [ OK ] 0.27 sec.
2024-08-31 12:55:40 01556_explain_select_with_union_query: [ OK ] 0.30 sec.
2024-08-31 12:55:40 01554_interpreter_integer_float: [ OK ] 0.24 sec.
2024-08-31 12:55:40 01632_tinylog_read_write: [ OK ] 11.73 sec.
2024-08-31 12:55:40 01553_datetime64_comparison: [ OK ] 0.23 sec.
2024-08-31 12:55:40 01552_dict_fixedstring: [ OK ] 0.25 sec.
2024-08-31 12:55:40 01551_mergetree_read_in_order_spread: [ OK ] 0.28 sec.
2024-08-31 12:55:40 01583_parallel_parsing_exception_with_offset: [ OK ] 4.33 sec.
2024-08-31 12:55:40 01550_mutation_subquery: [ OK ] 0.28 sec.
2024-08-31 12:55:41 01654_test_writer_block_sequence: [ OK ] 14.09 sec.
2024-08-31 12:55:41 01549_low_cardinality_mv_fuzz: [ OK ] 0.24 sec.
2024-08-31 12:55:41 01549_low_cardinality_materialized_view: [ OK ] 0.25 sec.
2024-08-31 12:55:41 01548_uncomparable_columns_in_keys: [ OK ] 0.25 sec.
2024-08-31 12:55:41 01548_with_totals_having: [ OK ] 0.20 sec.
2024-08-31 12:55:41 01550_create_map_type: [ OK ] 0.70 sec.
2024-08-31 12:55:41 01576_alter_low_cardinality_and_select: [ OK ] 4.12 sec.
2024-08-31 12:55:41 01554_row_number_after_cannot_read_all_data: [ OK ] 1.76 sec.
2024-08-31 12:55:41 01545_url_file_format_settings: [ OK ] 0.33 sec.
2024-08-31 12:55:42 01547_query_log_current_database: [ OK ] 0.54 sec.
2024-08-31 12:55:42 01544_errorCodeToName: [ OK ] 0.23 sec.
2024-08-31 12:55:42 01544_fromModifiedJulianDay: [ OK ] 0.33 sec.
2024-08-31 12:55:42 01542_collate_in_array: [ OK ] 0.26 sec.
2024-08-31 12:55:42 01540_verbatim_partition_pruning: [ OK ] 0.30 sec.
2024-08-31 12:55:42 01538_fuzz_aggregate: [ OK ] 0.24 sec.
2024-08-31 12:55:42 01535_decimal_round_scale_overflow_check: [ OK ] 0.26 sec.
2024-08-31 12:55:42 01558_ttest_scipy: [ OK ] 2.64 sec.
2024-08-31 12:55:42 01533_distinct_depends_on_max_threads: [ OK ] 0.37 sec.
2024-08-31 12:55:42 01532_having_with_totals: [ OK ] 0.30 sec.
2024-08-31 12:55:42 01532_collate_in_low_cardinality: [ OK ] 0.27 sec.
2024-08-31 12:55:43 01532_tuple_with_name_type: [ OK ] 0.25 sec.
2024-08-31 12:55:43 01550_query_identifier_parameters: [ OK ] 2.53 sec.
2024-08-31 12:55:43 01548_create_table_compound_column_format: [ OK ] 1.78 sec.
2024-08-31 12:55:43 01532_primary_key_without_order_by_zookeeper: [ OK ] 0.43 sec.
2024-08-31 12:55:43 01528_to_uuid_or_null_or_zero: [ OK ] 0.33 sec.
2024-08-31 12:55:43 01529_union_distinct_and_setting_union_default_mode: [ OK ] 0.39 sec.
2024-08-31 12:55:43 01531_query_log_query_comment: [ OK ] 0.74 sec.
2024-08-31 12:55:43 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 0.27 sec.
2024-08-31 12:55:43 01528_setting_aggregate_functions_null_for_empty: [ OK ] 0.36 sec.
2024-08-31 12:55:43 01544_file_engine_settings: [ OK ] 2.05 sec.
2024-08-31 12:55:44 01527_bad_aggregation_in_lambda: [ OK ] 0.23 sec.
2024-08-31 12:55:44 01532_clickhouse_local_tmp_folder: [ OK ] 1.66 sec.
2024-08-31 12:55:44 01525_select_with_offset_fetch_clause: [ OK ] 0.25 sec.
2024-08-31 12:55:44 01527_materialized_view_stack_overflow: [ OK ] 0.86 sec.
2024-08-31 12:55:44 01523_interval_operator_support_string_literal: [ OK ] 0.28 sec.
2024-08-31 12:55:44 01522_validate_alter_default: [ OK ] 0.26 sec.
2024-08-31 12:55:44 01521_max_length_alias: [ OK ] 0.26 sec.
2024-08-31 12:55:44 01550_type_map_formats_input: [ OK ] 4.21 sec.
2024-08-31 12:55:45 01521_alter_enum_and_reverse_read: [ OK ] 0.28 sec.
2024-08-31 12:55:45 01521_format_readable_time_delta2: [ OK ] 0.28 sec.
2024-08-31 12:55:45 01519_topK_distributed_parametrized: [ OK ] 0.27 sec.
2024-08-31 12:55:45 01518_filtering_aliased_materialized_column: [ OK ] 0.24 sec.
2024-08-31 12:55:45 01526_param_uuid: [ OK ] 1.69 sec.
2024-08-31 12:55:45 01518_nullable_aggregate_states1: [ OK ] 0.30 sec.
2024-08-31 12:55:45 01518_cast_nullable_virtual_system_column: [ OK ] 0.23 sec.
2024-08-31 12:55:46 01526_initial_query_id: [ OK ] 2.47 sec.
2024-08-31 12:55:46 01529_bad_memory_tracking: [ OK ] 3.40 sec.
2024-08-31 12:55:46 01520_client_print_query_id: [ OK ] 1.64 sec.
2024-08-31 12:55:46 01518_select_in_null: [ OK ] 1.02 sec.
2024-08-31 12:55:46 01514_input_format_json_enum_as_number: [ OK ] 0.23 sec.
2024-08-31 12:55:46 01514_empty_buffer_different_types: [ OK ] 0.25 sec.
2024-08-31 12:55:46 01523_client_local_queries_file_parameter: [ OK ] 2.75 sec.
2024-08-31 12:55:46 01513_defaults_on_defaults_no_column: [ OK ] 0.27 sec.
2024-08-31 12:55:47 01528_clickhouse_local_prepare_parts: [ OK ] 3.69 sec.
2024-08-31 12:55:47 01513_count_without_select_sequence_consistency_zookeeper_long: [ OK ] 0.39 sec.
2024-08-31 12:55:47 01512_create_replicate_merge_tree_one_arg: [ OK ] 0.22 sec.
2024-08-31 12:55:47 01511_different_expression_with_same_alias: [ OK ] 0.23 sec.
2024-08-31 12:55:47 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 0.36 sec.
2024-08-31 12:55:47 01515_logtrace_function: [ OK ] 1.56 sec.
2024-08-31 12:55:48 01518_nullable_aggregate_states2: [ OK ] 3.25 sec.
2024-08-31 12:55:48 01509_dictionary_preallocate: [ OK ] 1.60 sec.
2024-08-31 12:55:49 01509_format_raw_blob: [ OK ] 2.18 sec.
2024-08-31 12:55:49 01508_explain_header: [ OK ] 0.21 sec.
2024-08-31 12:55:49 01507_transform_null_in: [ OK ] 0.24 sec.
2024-08-31 12:55:49 01506_buffer_table_alter_block_structure: [ OK ] 0.27 sec.
2024-08-31 12:55:50 01505_trivial_count_with_partition_predicate: [ OK ] 0.87 sec.
2024-08-31 12:55:51 01508_query_obfuscator: [ OK ] 2.23 sec.
2024-08-31 12:55:51 01508_format_regexp_raw: [ OK ] 2.34 sec.
2024-08-31 12:55:51 01505_log_distributed_deadlock: [ OK ] 0.23 sec.
2024-08-31 12:55:51 01502_jemalloc_percpu_arena: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:55:52 01502_bar_overflow: [ OK ] 0.91 sec.
2024-08-31 12:55:52 01499_log_deadlock: [ OK ] 0.36 sec.
2024-08-31 12:55:52 01499_json_named_tuples: [ OK ] 0.28 sec.
2024-08-31 12:55:52 01498_alter_column_storage_memory: [ OK ] 0.25 sec.
2024-08-31 12:55:53 01513_optimize_aggregation_in_order_memory_long: [ OK ] 6.48 sec.
2024-08-31 12:55:53 01504_rocksdb: [ OK ] 2.05 sec.
2024-08-31 12:55:53 01497_alias_on_default_array: [ OK ] 0.26 sec.
2024-08-31 12:55:53 01497_now_support_timezone: [ OK ] 0.23 sec.
2024-08-31 12:55:53 01497_mutation_support_for_storage_memory: [ OK ] 0.27 sec.
2024-08-31 12:55:53 01497_extract_all_groups_empty_match: [ OK ] 0.24 sec.
2024-08-31 12:55:53 01509_check_many_parallel_quorum_inserts_long: [ OK ] 6.22 sec.
2024-08-31 12:55:53 01509_parallel_quorum_and_merge_long: [ OK ] 6.34 sec.
2024-08-31 12:55:53 01496_signedness_conversion_monotonicity: [ OK ] 0.23 sec.
2024-08-31 12:55:53 01493_table_function_null: [ OK ] 0.25 sec.
2024-08-31 12:55:53 01492_array_join_crash_13829: [ OK ] 0.22 sec.
2024-08-31 12:55:53 01492_format_readable_quantity: [ OK ] 0.26 sec.
2024-08-31 12:55:53 01490_nullable_string_to_enum: [ OK ] 0.26 sec.
2024-08-31 12:55:53 01483_merge_table_join_and_group_by: [ OK ] 0.32 sec.
2024-08-31 12:55:54 01475_fix_bigint_shift: [ OK ] 0.23 sec.
2024-08-31 12:55:54 01480_binary_operator_monotonicity: [ OK ] 0.46 sec.
2024-08-31 12:55:54 01476_right_full_join_switch: [ OK ] 0.32 sec.
2024-08-31 12:55:54 01477_lc_in_merge_join_left_key: [ OK ] 0.55 sec.
2024-08-31 12:55:54 01475_read_subcolumns_2: [ OK ] 0.33 sec.
2024-08-31 12:55:54 01474_decimal_scale_bug: [ OK ] 0.29 sec.
2024-08-31 12:55:54 01475_read_subcolumns_3: [ OK ] 0.37 sec.
2024-08-31 12:55:54 01473_system_events_zeroes: [ OK ] 0.25 sec.
2024-08-31 12:55:54 01472_many_rows_in_totals: [ OK ] 0.28 sec.
2024-08-31 12:55:54 01471_with_format: [ OK ] 0.22 sec.
2024-08-31 12:55:54 01471_top_k_range_check: [ OK ] 0.27 sec.
2024-08-31 12:55:54 01470_explain: [ OK ] 0.20 sec.
2024-08-31 12:55:55 01470_test_insert_select_asterisk: [ OK ] 0.32 sec.
2024-08-31 12:55:55 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 0.60 sec.
2024-08-31 12:55:55 01470_columns_transformers: [ OK ] 0.53 sec.
2024-08-31 12:55:55 01470_columns_transformers2: [ OK ] 0.26 sec.
2024-08-31 12:55:55 01463_resample_overflow: [ OK ] 0.22 sec.
2024-08-31 12:55:55 01460_allow_dollar_and_number_in_identifier: [ OK ] 0.23 sec.
2024-08-31 12:55:55 01460_mark_inclusion_search_crash: [ OK ] 0.28 sec.
2024-08-31 12:55:55 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.23 sec.
2024-08-31 12:55:55 01458_count_digits: [ OK ] 0.26 sec.
2024-08-31 12:55:55 01461_query_start_time_microseconds: [ OK ] 0.87 sec.
2024-08-31 12:55:55 01458_named_tuple_millin: [ OK ] 0.23 sec.
2024-08-31 12:55:56 01458_is_decimal_overflow: [ OK ] 0.27 sec.
2024-08-31 12:55:56 01457_int256_hashing: [ OK ] 0.28 sec.
2024-08-31 12:55:56 01457_order_by_nulls_first: [ OK ] 0.28 sec.
2024-08-31 12:55:56 01456_low_cardinality_sorting_bugfix: [ OK ] 0.30 sec.
2024-08-31 12:55:56 01474_custom_null_tsv: [ OK ] 2.35 sec.
2024-08-31 12:55:56 01453_normalize_query_alias_uuid: [ OK ] 0.24 sec.
2024-08-31 12:55:56 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.24 sec.
2024-08-31 12:55:56 01451_replicated_detach_drop_part_long: [ OK ] 0.43 sec.
2024-08-31 12:55:56 01451_detach_drop_part: [ OK ] 0.35 sec.
2024-08-31 12:55:56 01451_replicated_detach_drop_and_quorum_long: [ OK ] 0.43 sec.
2024-08-31 12:55:57 01450_set_null_const: [ OK ] 0.26 sec.
2024-08-31 12:55:57 01514_parallel_formatting: [ OK ] 10.65 sec.
2024-08-31 12:55:57 01448_json_compact_strings_each_row: [ OK ] 0.43 sec.
2024-08-31 12:55:57 01442_h3kring_range_check: [ OK ] 0.33 sec.
2024-08-31 12:55:57 01441_array_combinator: [ OK ] 0.23 sec.
2024-08-31 12:55:57 01442_date_time_with_params: [ OK ] 0.55 sec.
2024-08-31 12:55:58 01451_wrong_error_long_query: [ OK ] 1.56 sec.
2024-08-31 12:55:58 01440_big_int_shift: [ OK ] 0.24 sec.
2024-08-31 12:55:58 01440_big_int_exotic_casts: [ OK ] 0.38 sec.
2024-08-31 12:55:58 01433_hex_float: [ OK ] 0.22 sec.
2024-08-31 12:55:58 01436_storage_merge_with_join_push_down: [ OK ] 0.26 sec.
2024-08-31 12:55:58 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.24 sec.
2024-08-31 12:55:58 01431_utf8_ubsan: [ OK ] 0.24 sec.
2024-08-31 12:55:58 01430_fix_any_rewrite_aliases: [ OK ] 0.24 sec.
2024-08-31 12:55:58 01428_h3_range_check: [ OK ] 0.28 sec.
2024-08-31 12:55:58 01430_modify_sample_by_zookeeper_long: [ OK ] 0.59 sec.
2024-08-31 12:55:59 01428_hash_set_nan_key: [ OK ] 0.31 sec.
2024-08-31 12:55:59 01427_pk_and_expression_with_different_type: [ OK ] 0.28 sec.
2024-08-31 12:55:59 01445_create_table_as_table_function: [ OK ] 2.11 sec.
2024-08-31 12:55:59 01425_decimal_parse_big_negative_exponent: [ OK ] 0.32 sec.
2024-08-31 12:55:59 01425_default_value_of_type_name: [ OK ] 0.24 sec.
2024-08-31 12:55:59 01424_parse_date_time_bad_date: [ OK ] 0.24 sec.
2024-08-31 12:55:59 01423_if_nullable_cond: [ OK ] 0.23 sec.
2024-08-31 12:55:59 01421_assert_in_in: [ OK ] 0.23 sec.
2024-08-31 12:55:59 01421_array_nullable_element_nullable_index: [ OK ] 0.24 sec.
2024-08-31 12:55:59 01417_update_permutation_crash: [ OK ] 0.21 sec.
2024-08-31 12:55:59 01419_merge_tree_settings_sanity_check: [ OK ] 0.34 sec.
2024-08-31 12:55:59 01418_index_analysis_bug: [ OK ] 0.33 sec.
2024-08-31 12:55:59 01416_clear_column_pk: [ OK ] 0.26 sec.
2024-08-31 12:56:00 01416_join_totals_header_bug: [ OK ] 0.28 sec.
2024-08-31 12:56:00 01414_freeze_does_not_prevent_alters: [ OK ] 0.31 sec.
2024-08-31 12:56:00 01413_alter_update_supertype: [ OK ] 0.27 sec.
2024-08-31 12:56:00 01413_if_array_uuid: [ OK ] 0.22 sec.
2024-08-31 12:56:00 01413_truncate_without_table_keyword: [ OK ] 0.28 sec.
2024-08-31 12:56:00 01412_row_from_totals: [ OK ] 0.31 sec.
2024-08-31 12:56:00 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 13.01 sec.
2024-08-31 12:56:00 01411_xor_itai_shirav: [ OK ] 0.22 sec.
2024-08-31 12:56:00 01412_group_array_moving_shard: [ OK ] 0.46 sec.
2024-08-31 12:56:00 01410_nullable_key_and_index_negate_cond: [ OK ] 0.29 sec.
2024-08-31 12:56:00 01414_low_cardinality_nullable: [ OK ] 0.99 sec.
2024-08-31 12:56:00 01410_full_join_and_null_predicates: [ OK ] 0.33 sec.
2024-08-31 12:56:01 01409_topK_merge: [ OK ] 0.29 sec.
2024-08-31 12:56:01 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 0.26 sec.
2024-08-31 12:56:01 01410_nullable_key_and_index: [ OK ] 0.50 sec.
2024-08-31 12:56:01 01403_datetime64_constant_arg: [ OK ] 0.24 sec.
2024-08-31 12:56:01 01398_in_tuple_func: [ OK ] 0.27 sec.
2024-08-31 12:56:01 01402_cast_nullable_string_to_enum: [ OK ] 0.34 sec.
2024-08-31 12:56:01 01390_remove_injective_in_uniq: [ OK ] 0.25 sec.
2024-08-31 12:56:01 01460_line_as_string_format: [ OK ] 6.48 sec.
2024-08-31 12:56:01 01389_filter_by_virtual_columns: [ OK ] 0.23 sec.
2024-08-31 12:56:01 01505_pipeline_executor_UAF: [ OK ] 10.78 sec.
2024-08-31 12:56:01 01388_multi_if_optimization: [ OK ] 0.24 sec.
2024-08-31 12:56:01 01386_negative_float_constant_key_condition: [ OK ] 0.30 sec.
2024-08-31 12:56:02 01387_clear_column_default_depends: [ OK ] 0.39 sec.
2024-08-31 12:56:02 01385_not_function: [ OK ] 0.23 sec.
2024-08-31 12:56:02 01384_bloom_filter_bad_arguments: [ OK ] 0.34 sec.
2024-08-31 12:56:02 01381_for_each_with_states: [ OK ] 0.28 sec.
2024-08-31 12:56:02 01379_with_fill_several_columns: [ OK ] 0.27 sec.
2024-08-31 12:56:02 01380_nullable_state: [ OK ] 0.55 sec.
2024-08-31 12:56:02 01377_supertype_low_cardinality: [ OK ] 0.34 sec.
2024-08-31 12:56:02 01399_http_request_headers: [ OK ] 1.65 sec.
2024-08-31 12:56:02 01376_array_fill_empty: [ OK ] 0.22 sec.
2024-08-31 12:56:02 01375_null_issue_3767: [ OK ] 0.25 sec.
2024-08-31 12:56:02 01374_if_nullable_filimonov: [ OK ] 0.23 sec.
2024-08-31 12:56:02 01359_geodistance_loop: [ OK ] 0.21 sec.
2024-08-31 12:56:02 01362_year_of_ISO8601_week_modificators_for_formatDateTime: [ OK ] 0.23 sec.
2024-08-31 12:56:03 01359_codeql: [ OK ] 0.22 sec.
2024-08-31 12:56:03 01358_constexpr_constraint: [ OK ] 0.25 sec.
2024-08-31 12:56:03 01358_mutation_delete_null_rows: [ OK ] 0.29 sec.
2024-08-31 12:56:03 01356_initialize_aggregation: [ OK ] 0.29 sec.
2024-08-31 12:56:03 01406_carriage_return_in_tsv_csv: [ OK ] 2.67 sec.
2024-08-31 12:56:03 01356_state_resample: [ OK ] 0.30 sec.
2024-08-31 12:56:03 01354_order_by_tuple_collate_const: [ OK ] 0.22 sec.
2024-08-31 12:56:03 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 0.24 sec.
2024-08-31 12:56:03 01353_topk_enum: [ OK ] 0.24 sec.
2024-08-31 12:56:03 01353_neighbor_overflow: [ OK ] 0.25 sec.
2024-08-31 12:56:04 01353_low_cardinality_join_types: [ OK ] 0.41 sec.
2024-08-31 12:56:04 01352_generate_random_overflow: [ OK ] 0.25 sec.
2024-08-31 12:56:04 01353_nullable_tuple: [ OK ] 0.56 sec.
2024-08-31 12:56:04 01351_geohash_assert: [ OK ] 0.22 sec.
2024-08-31 12:56:04 01446_json_strings_each_row: [ OK ] 7.50 sec.
2024-08-31 12:56:04 01345_array_join_LittleMaverick: [ OK ] 0.27 sec.
2024-08-31 12:56:04 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 0.58 sec.
2024-08-31 12:56:04 01333_select_abc_asterisk: [ OK ] 0.25 sec.
2024-08-31 12:56:04 01343_min_bytes_to_use_mmap_io: [ OK ] 0.59 sec.
2024-08-31 12:56:04 01330_array_join_in_higher_order_function: [ OK ] 0.23 sec.
2024-08-31 12:56:05 01328_bad_peephole_optimization: [ OK ] 0.24 sec.
2024-08-31 12:56:05 01326_hostname_alias: [ OK ] 0.22 sec.
2024-08-31 12:56:05 01326_build_id: [ OK ] 0.25 sec.
2024-08-31 12:56:05 01324_settings_documentation: [ OK ] 0.23 sec.
2024-08-31 12:56:05 01323_add_scalars_in_time: [ OK ] 0.32 sec.
2024-08-31 12:56:05 01323_redundant_functions_in_order_by: [ OK ] 0.45 sec.
2024-08-31 12:56:05 01323_if_with_nulls: [ OK ] 0.32 sec.
2024-08-31 12:56:05 01322_monotonous_order_by_with_different_variables: [ OK ] 0.31 sec.
2024-08-31 12:56:05 01322_cast_keep_nullable: [ OK ] 0.26 sec.
2024-08-31 12:56:06 01321_monotonous_functions_in_order_by: [ OK ] 0.39 sec.
2024-08-31 12:56:06 01318_alter_add_column_exists: [ OK ] 0.25 sec.
2024-08-31 12:56:06 01355_CSV_input_format_allow_errors: [ OK ] 2.96 sec.
2024-08-31 12:56:06 01319_query_formatting_in_server_log: [ OK ] 0.61 sec.
2024-08-31 12:56:06 01318_map_populate_series: [ OK ] 0.48 sec.
2024-08-31 12:56:06 01312_case_insensitive_regexp: [ OK ] 0.23 sec.
2024-08-31 12:56:06 01339_client_unrecognized_option: [ OK ] 2.32 sec.
2024-08-31 12:56:06 01318_encrypt: [ OK ] 0.72 sec.
2024-08-31 12:56:07 01307_polygon_perimeter: [ OK ] 0.22 sec.
2024-08-31 12:56:07 01308_row_policy_and_trivial_count_query: [ OK ] 0.29 sec.
2024-08-31 12:56:07 01303_polygons_equals: [ OK ] 0.24 sec.
2024-08-31 12:56:07 01305_polygons_union: [ OK ] 0.33 sec.
2024-08-31 12:56:07 01302_polygons_distance: [ OK ] 0.25 sec.
2024-08-31 12:56:07 01301_polygons_within: [ OK ] 0.27 sec.
2024-08-31 12:56:07 01300_wkt: [ OK ] 0.30 sec.
2024-08-31 12:56:07 01300_svg: [ OK ] 0.44 sec.
2024-08-31 12:56:08 01293_show_settings: [ OK ] 0.21 sec.
2024-08-31 12:56:08 01293_external_sorting_limit_bug: [ OK ] 0.26 sec.
2024-08-31 12:56:08 01358_lc_parquet: [ OK ] 5.56 sec.
2024-08-31 12:56:08 01293_pretty_max_value_width: [ OK ] 0.27 sec.
2024-08-31 12:56:08 01292_quantile_array_bug: [ OK ] 0.21 sec.
2024-08-31 12:56:09 01308_orc_output_format_arrays: [ OK ] 2.35 sec.
2024-08-31 12:56:09 01291_distributed_low_cardinality_memory_efficient: [ OK ] 0.24 sec.
2024-08-31 12:56:09 01307_orc_output_format: [ OK ] 2.88 sec.
2024-08-31 12:56:09 01289_min_execution_speed_not_too_early: [ OK ] 0.50 sec.
2024-08-31 12:56:10 01300_group_by_other_keys_having: [ OK ] 2.14 sec.
2024-08-31 12:56:10 01293_client_interactive_vertical_singleline: [ OK ] 1.55 sec.
2024-08-31 12:56:10 01284_view_and_extremes_bug: [ OK ] 0.23 sec.
2024-08-31 12:56:10 01284_escape_sequences_php_mysql_style: [ OK ] 0.24 sec.
2024-08-31 12:56:10 01284_port: [ OK ] 0.43 sec.
2024-08-31 12:56:11 01317_no_password_in_command_line: [ OK ] 4.77 sec.
2024-08-31 12:56:11 01283_max_threads_simple_query_optimization: [ OK ] 0.70 sec.
2024-08-31 12:56:11 01283_strict_resize_bug: [ OK ] 0.40 sec.
2024-08-31 12:56:11 01282_system_parts_ttl_info: [ OK ] 0.25 sec.
2024-08-31 12:56:11 01281_sum_nullable: [ OK ] 0.23 sec.
2024-08-31 12:56:11 01290_max_execution_speed_distributed: [ OK ] 2.42 sec.
2024-08-31 12:56:11 01281_parseDateTime64BestEffort: [ OK ] 0.44 sec.
2024-08-31 12:56:11 01280_unicode_whitespaces_lexer: [ OK ] 0.21 sec.
2024-08-31 12:56:11 01280_null_in: [ OK ] 0.24 sec.
2024-08-31 12:56:11 01280_min_map_max_map: [ OK ] 0.45 sec.
2024-08-31 12:56:12 01277_fromUnixTimestamp64: [ OK ] 0.32 sec.
2024-08-31 12:56:12 01278_variance_nonnegative: [ OK ] 0.42 sec.
2024-08-31 12:56:12 01277_large_tuples: [ OK ] 0.23 sec.
2024-08-31 12:56:12 01288_shard_max_network_bandwidth: [ OK ] 2.70 sec.
2024-08-31 12:56:12 01276_system_licenses: [ OK ] 0.22 sec.
2024-08-31 12:56:12 01276_alter_rename_column_materialized_expr: [ OK ] 0.38 sec.
2024-08-31 12:56:13 01274_alter_rename_column_distributed: [ OK ] 0.27 sec.
2024-08-31 12:56:13 01278_format_multiple_queries: [ OK ] 1.54 sec.
2024-08-31 12:56:13 01276_random_string: [ OK ] 1.31 sec.
2024-08-31 12:56:13 01279_empty_external_table: [ OK ] 2.01 sec.
2024-08-31 12:56:13 01273_h3EdgeAngle_range_check: [ OK ] 0.23 sec.
2024-08-31 12:56:13 01274_generate_random_nested: [ OK ] 1.40 sec.
2024-08-31 12:56:14 01287_max_execution_speed: [ OK ] 4.27 sec.
2024-08-31 12:56:14 01273_lc_fixed_string_field: [ OK ] 0.26 sec.
2024-08-31 12:56:16 01273_arrow_nested_arrays_load: [ OK ] 2.90 sec.
2024-08-31 12:56:16 01273_arrow_decimal: [ OK ] 2.76 sec.
2024-08-31 12:56:17 01273_arrow_nullable_arrays_load: [ OK ] 2.95 sec.
2024-08-31 12:56:17 01272_offset_without_limit: [ OK ] 0.23 sec.
2024-08-31 12:56:17 01272_totals_and_filter_bug: [ OK ] 0.27 sec.
2024-08-31 12:56:17 01271_show_privileges: [ OK ] 0.25 sec.
2024-08-31 12:56:18 01269_create_with_null: [ OK ] 0.32 sec.
2024-08-31 12:56:18 01273_arrow_load: [ OK ] 2.39 sec.
2024-08-31 12:56:18 01268_mv_scalars: [ OK ] 0.34 sec.
2024-08-31 12:56:18 01268_mergine_sorted_limit: [ OK ] 0.25 sec.
2024-08-31 12:56:19 01273_arrow_dictionaries_load: [ OK ] 6.03 sec.
2024-08-31 12:56:19 01267_alter_default_key_columns_zookeeper_long: [ OK ] 0.35 sec.
2024-08-31 12:56:19 01273_arrow_arrays_load: [ OK ] 2.85 sec.
2024-08-31 12:56:19 01264_nested_baloo_bear: [ OK ] 0.25 sec.
2024-08-31 12:56:19 01259_datetime64_ubsan: [ OK ] 0.25 sec.
2024-08-31 12:56:19 01262_low_cardinality_remove: [ OK ] 0.30 sec.
2024-08-31 12:56:19 01259_combinator_distinct: [ OK ] 0.31 sec.
2024-08-31 12:56:19 01256_misspell_layout_name_podshumok: [ OK ] 0.25 sec.
2024-08-31 12:56:19 01255_geo_types_livace: [ OK ] 0.25 sec.
2024-08-31 12:56:19 01251_string_comparison: [ OK ] 0.30 sec.
2024-08-31 12:56:20 01250_fixed_string_comparison: [ OK ] 0.25 sec.
2024-08-31 12:56:20 01247_least_greatest_filimonov: [ OK ] 0.23 sec.
2024-08-31 12:56:20 01246_extractAllGroupsVertical: [ OK ] 0.35 sec.
2024-08-31 12:56:20 01268_procfs_metrics: [ OK ] 1.97 sec.
2024-08-31 12:56:20 01383_log_broken_table: [ OK ] 19.04 sec.
2024-08-31 12:56:21 01244_optimize_distributed_group_by_sharding_key: [ OK ] 0.93 sec.
2024-08-31 12:56:21 01234_to_string_monotonic: [ OK ] 0.49 sec.
2024-08-31 12:56:21 01245_limit_infinite_sources: [ OK ] 1.17 sec.
2024-08-31 12:56:21 01232_untuple: [ OK ] 0.31 sec.
2024-08-31 12:56:21 01230_join_get_truncate: [ OK ] 0.25 sec.
2024-08-31 12:56:22 01220_scalar_optimization_in_alter: [ OK ] 0.21 sec.
2024-08-31 12:56:22 01214_test_storage_merge_aliases_with_where: [ OK ] 0.33 sec.
2024-08-31 12:56:22 01213_alter_rename_nested: [ OK ] 0.34 sec.
2024-08-31 12:56:22 01214_point_in_Mecca: [ OK ] 0.85 sec.
2024-08-31 12:56:22 01213_alter_table_rename_nested: [ OK ] 0.32 sec.
2024-08-31 12:56:22 01231_operator_null_in: [ OK ] 1.43 sec.
2024-08-31 12:56:23 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 0.31 sec.
2024-08-31 12:56:23 01202_array_auc_special: [ OK ] 0.31 sec.
2024-08-31 12:56:23 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.23 sec.
2024-08-31 12:56:23 01201_drop_column_compact_part_replicated_zookeeper_long: [ OK ] 0.54 sec.
2024-08-31 12:56:23 01189_create_as_table_as_table_function: [ OK ] 0.25 sec.
2024-08-31 12:56:25 01196_max_parser_depth: [ OK ] 1.83 sec.
2024-08-31 12:56:25 01198_client_quota_key: [ OK ] 2.29 sec.
2024-08-31 12:56:25 01186_conversion_to_nullable: [ OK ] 0.24 sec.
2024-08-31 12:56:25 01395_limit_more_cases: [ OK ] 24.34 sec.
2024-08-31 12:56:25 01187_set_profile_as_setting: [ OK ] 2.08 sec.
2024-08-31 12:56:25 01182_materialized_view_different_structure: [ OK ] 0.42 sec.
2024-08-31 12:56:27 01176_mysql_client_interactive: [ OK ] 1.94 sec.
2024-08-31 12:56:27 01273_arrow_stream: [ OK ] 14.04 sec.
2024-08-31 12:56:28 01273_arrow: [ OK ] 13.98 sec.
2024-08-31 12:56:28 01246_buffer_flush: [ OK ] 8.31 sec.
2024-08-31 12:56:28 01149_zookeeper_mutation_stuck_after_replace_partition: [ OK ] 0.80 sec.
2024-08-31 12:56:29 01165_lost_part_empty_partition: [ OK ] 3.07 sec.
2024-08-31 12:56:29 01144_multiword_data_types: [ OK ] 0.22 sec.
2024-08-31 12:56:29 01147_partial_merge_full_join: [ OK ] 0.69 sec.
2024-08-31 12:56:29 01143_trivial_count_with_join: [ OK ] 0.24 sec.
2024-08-31 12:56:29 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 0.29 sec.
2024-08-31 12:56:29 01183_custom_separated_format_http: [ OK ] 3.98 sec.
2024-08-31 12:56:29 01139_asof_join_types: [ OK ] 0.30 sec.
2024-08-31 12:56:29 01137_sample_final: [ OK ] 0.28 sec.
2024-08-31 12:56:29 01136_multiple_sets: [ OK ] 0.25 sec.
2024-08-31 12:56:29 01170_alter_partition_isolation: [ OK ] 3.85 sec.
2024-08-31 12:56:29 01135_default_and_alter_zookeeper: [ OK ] 0.29 sec.
2024-08-31 12:56:29 01131_max_rows_to_sort: [ OK ] 0.25 sec.
2024-08-31 12:56:29 01134_max_rows_to_group_by: [ OK ] 0.30 sec.
2024-08-31 12:56:29 01123_parse_date_time_best_effort_even_more: [ OK ] 0.21 sec.
2024-08-31 12:56:30 01125_generate_random_qoega: [ OK ] 0.41 sec.
2024-08-31 12:56:30 01122_totals_rollup_having_block_header: [ OK ] 0.23 sec.
2024-08-31 12:56:30 01120_join_constants: [ OK ] 0.24 sec.
2024-08-31 12:56:30 01121_remote_scalar_subquery: [ OK ] 0.27 sec.
2024-08-31 12:56:30 01118_is_constant: [ OK ] 0.25 sec.
2024-08-31 12:56:30 01116_cross_count_asterisks: [ OK ] 0.24 sec.
2024-08-31 12:56:30 01116_asof_join_dolbyzerr: [ OK ] 0.25 sec.
2024-08-31 12:56:30 01119_optimize_trivial_insert_select: [ OK ] 0.40 sec.
2024-08-31 12:56:30 01115_prewhere_array_join: [ OK ] 0.54 sec.
2024-08-31 12:56:30 01107_join_right_table_totals: [ OK ] 0.40 sec.
2024-08-31 12:56:30 01115_join_with_dictionary: [ OK ] 0.53 sec.
2024-08-31 12:56:31 01106_const_fixed_string_like: [ OK ] 0.31 sec.
2024-08-31 12:56:31 01249_flush_interactive: [ OK ] 11.37 sec.
2024-08-31 12:56:31 01104_distributed_one_test: [ OK ] 0.34 sec.
2024-08-31 12:56:31 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:56:31 01104_distributed_numbers_test: [ OK ] 0.28 sec.
2024-08-31 12:56:31 01104_fixed_string_like: [ OK ] 0.33 sec.
2024-08-31 12:56:31 01102_distributed_local_in_bug: [ OK ] 0.25 sec.
2024-08-31 12:56:31 01100_split_by_string: [ OK ] 0.24 sec.
2024-08-31 12:56:31 01101_literal_column_clash: [ OK ] 0.26 sec.
2024-08-31 12:56:32 01097_one_more_range_reader_test_wide_part: [ OK ] 0.26 sec.
2024-08-31 12:56:32 01098_sum: [ OK ] 0.28 sec.
2024-08-31 12:56:32 01099_operators_date_and_timestamp: [ OK ] 0.61 sec.
2024-08-31 12:56:32 01097_pre_limit: [ OK ] 0.23 sec.
2024-08-31 12:56:32 01096_block_serialized_state: [ OK ] 0.22 sec.
2024-08-31 12:56:32 01097_cyclic_defaults: [ OK ] 0.38 sec.
2024-08-31 12:56:32 01096_zeros: [ OK ] 0.31 sec.
2024-08-31 12:56:32 01107_tuples_arrays_parsing_exceptions: [ OK ] 1.75 sec.
2024-08-31 12:56:32 01093_cyclic_defaults_filimonov: [ OK ] 0.29 sec.
2024-08-31 12:56:32 01090_fixed_string_bit_ops: [ OK ] 0.22 sec.
2024-08-31 12:56:32 01091_insert_with_default_json: [ OK ] 0.26 sec.
2024-08-31 12:56:32 01089_alter_settings_old_format: [ OK ] 0.26 sec.
2024-08-31 12:56:33 01088_array_slice_of_aggregate_functions: [ OK ] 0.24 sec.
2024-08-31 12:56:33 01095_tpch_like_smoke: [ OK ] 0.76 sec.
2024-08-31 12:56:33 01087_index_set_ubsan: [ OK ] 0.27 sec.
2024-08-31 12:56:33 01085_datetime_arithmetic_preserve_timezone: [ OK ] 0.25 sec.
2024-08-31 12:56:33 01085_simdjson_uint64: [ OK ] 0.22 sec.
2024-08-31 12:56:33 01085_extract_all_empty: [ OK ] 0.22 sec.
2024-08-31 12:56:33 01084_regexp_empty: [ OK ] 0.23 sec.
2024-08-31 12:56:33 01084_defaults_on_aliases: [ OK ] 0.27 sec.
2024-08-31 12:56:33 01083_cross_to_inner_with_in_bug: [ OK ] 0.24 sec.
2024-08-31 12:56:33 01083_aggregation_memory_efficient_bug: [ OK ] 0.34 sec.
2024-08-31 12:56:34 01083_match_zero_byte: [ OK ] 0.27 sec.
2024-08-31 12:56:34 01082_bit_test_out_of_bound: [ OK ] 0.24 sec.
2024-08-31 12:56:34 01081_demangle: [ OK ] 0.21 sec.
2024-08-31 12:56:35 01088_benchmark_query_id: [ OK ] 2.69 sec.
2024-08-31 12:56:36 01079_alter_default_zookeeper_long: [ OK ] 0.50 sec.
2024-08-31 12:56:36 01156_pcg_deserialization: [ OK ] 8.72 sec.
2024-08-31 12:56:36 01079_bit_operations_using_bitset: [ OK ] 0.25 sec.
2024-08-31 12:56:36 01083_window_view_select: [ OK ] 3.04 sec.
2024-08-31 12:56:36 01081_window_view_target_table_engine: [ OK ] 2.61 sec.
2024-08-31 12:56:36 01079_new_range_reader_segfault: [ OK ] 0.24 sec.
2024-08-31 12:56:37 01080_window_view_inner_table_memory_hop: [ OK ] 2.72 sec.
2024-08-31 12:56:37 01076_range_reader_segfault: [ OK ] 0.25 sec.
2024-08-31 12:56:37 01076_predicate_optimizer_with_view: [ OK ] 0.26 sec.
2024-08-31 12:56:39 01076_json_each_row_array: [ OK ] 2.98 sec.
2024-08-31 12:56:39 01079_order_by_pk: [ OK ] 3.11 sec.
2024-08-31 12:56:39 01075_allowed_client_hosts: [ OK ] 0.24 sec.
2024-08-31 12:56:40 01074_h3_range_check: [ OK ] 0.28 sec.
2024-08-31 12:56:40 01077_mutations_index_consistency: [ OK ] 3.49 sec.
2024-08-31 12:56:40 01073_crlf_end_of_line: [ OK ] 0.25 sec.
2024-08-31 12:56:40 01073_bad_alter_partition: [ OK ] 0.29 sec.
2024-08-31 12:56:40 01155_old_mutation_parts_to_do: [ OK ] 12.77 sec.
2024-08-31 12:56:40 01073_show_tables_not_like: [ OK ] 0.30 sec.
2024-08-31 12:56:40 01072_json_each_row_data_in_square_brackets: [ OK ] 0.23 sec.
2024-08-31 12:56:40 01072_select_constant_limit: [ OK ] 0.21 sec.
2024-08-31 12:56:40 01072_drop_temporary_table_with_same_name: [ OK ] 0.27 sec.
2024-08-31 12:56:40 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 0.41 sec.
2024-08-31 12:56:40 01071_force_optimize_skip_unused_shards: [ OK ] 0.36 sec.
2024-08-31 12:56:40 01071_prohibition_secondary_index_with_old_format_merge_tree: [ OK ] 0.25 sec.
2024-08-31 12:56:40 01075_window_view_proc_tumble_to_now_populate: [ OK ] 3.25 sec.
2024-08-31 12:56:41 01071_in_array: [ OK ] 0.25 sec.
2024-08-31 12:56:41 01070_h3_to_parent: [ OK ] 0.24 sec.
2024-08-31 12:56:41 01070_string_to_h3: [ OK ] 0.21 sec.
2024-08-31 12:56:41 01070_alter_with_ttl: [ OK ] 0.23 sec.
2024-08-31 12:56:41 01069_insert_float_as_nullable_unit8: [ OK ] 0.22 sec.
2024-08-31 12:56:41 01068_parens: [ OK ] 0.22 sec.
2024-08-31 12:56:41 01069_materialized_view_alter_target_table: [ OK ] 0.27 sec.
2024-08-31 12:56:41 01067_join_null: [ OK ] 0.23 sec.
2024-08-31 12:56:41 01065_if_not_finite: [ OK ] 0.26 sec.
2024-08-31 12:56:41 01063_create_column_set: [ OK ] 0.24 sec.
2024-08-31 12:56:41 01062_pm_multiple_all_join_same_value: [ OK ] 0.23 sec.
2024-08-31 12:56:42 01064_pm_all_join_const_and_nullable: [ OK ] 0.67 sec.
2024-08-31 12:56:42 01060_defaults_all_columns: [ OK ] 0.24 sec.
2024-08-31 12:56:42 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 1.08 sec.
2024-08-31 12:56:43 01071_window_view_event_tumble_asc_join: [ OK ] 2.91 sec.
2024-08-31 12:56:43 01079_bad_alters_zookeeper_long: [ OK ] 7.42 sec.
2024-08-31 12:56:43 01056_predicate_optimizer_bugs: [ OK ] 0.40 sec.
2024-08-31 12:56:44 01060_window_view_event_tumble_to_asc: [ OK ] 2.74 sec.
2024-08-31 12:56:45 01058_window_view_event_hop_to_strict_asc: [ OK ] 2.83 sec.
2024-08-31 12:56:45 01056_prepared_statements_null_and_escaping: [ OK ] 1.48 sec.
2024-08-31 12:56:45 01055_prewhere_bugs: [ OK ] 0.25 sec.
2024-08-31 12:56:45 01053_drop_database_mat_view: [ OK ] 0.26 sec.
2024-08-31 12:56:46 01053_if_chain_check: [ OK ] 0.26 sec.
2024-08-31 12:56:46 01058_zlib_ng_level1_bug: [ OK ] 2.81 sec.
2024-08-31 12:56:46 01052_array_reduce_exception: [ OK ] 0.21 sec.
2024-08-31 12:56:46 01051_aggregate_function_crash: [ OK ] 0.21 sec.
2024-08-31 12:56:46 01051_new_any_join_engine: [ OK ] 0.57 sec.
2024-08-31 12:56:46 01051_same_name_alias_with_joins: [ OK ] 0.36 sec.
2024-08-31 12:56:47 01050_group_array_sample: [ OK ] 0.24 sec.
2024-08-31 12:56:47 01051_window_view_parser_hop: [ OK ] 0.53 sec.
2024-08-31 12:56:47 01050_engine_join_crash: [ OK ] 0.31 sec.
2024-08-31 12:56:47 01050_engine_join_view_crash: [ OK ] 0.25 sec.
2024-08-31 12:56:47 01049_window_view_window_functions: [ OK ] 0.31 sec.
2024-08-31 12:56:48 01049_zookeeper_synchronous_mutations_long: [ OK ] 0.45 sec.
2024-08-31 12:56:48 01049_join_low_card_crash: [ OK ] 0.27 sec.
2024-08-31 12:56:48 01054_random_printable_ascii_ubsan: [ OK ] 2.83 sec.
2024-08-31 12:56:48 01047_no_alias_columns_with_table_aliases: [ OK ] 0.24 sec.
2024-08-31 12:56:48 01045_array_zip: [ OK ] 0.27 sec.
2024-08-31 12:56:49 01045_bloom_filter_null_array: [ OK ] 0.31 sec.
2024-08-31 12:56:49 01044_h3_edge_angle: [ OK ] 0.23 sec.
2024-08-31 12:56:49 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 1.23 sec.
2024-08-31 12:56:49 01043_dictionary_attribute_properties_values: [ OK ] 0.24 sec.
2024-08-31 12:56:49 01043_categorical_iv: [ OK ] 0.35 sec.
2024-08-31 12:56:49 01043_h3_edge_length_m: [ OK ] 0.22 sec.
2024-08-31 12:56:50 01042_check_query_and_last_granule_size: [ OK ] 0.31 sec.
2024-08-31 12:56:50 01041_h3_is_valid: [ OK ] 0.22 sec.
2024-08-31 12:56:50 01040_h3_get_resolution: [ OK ] 0.22 sec.
2024-08-31 12:56:50 01040_distributed_background_insert_batch_inserts: [ OK ] 0.38 sec.
2024-08-31 12:56:51 01049_join_low_card_bug_long: [ OK ] 3.40 sec.
2024-08-31 12:56:51 01055_window_view_proc_hop_to: [ OK ] 6.78 sec.
2024-08-31 12:56:51 01038_array_of_unnamed_tuples: [ OK ] 0.24 sec.
2024-08-31 12:56:51 01037_zookeeper_check_table_empty_pk: [ OK ] 0.27 sec.
2024-08-31 12:56:51 01039_mergetree_exec_time: [ OK ] 1.33 sec.
2024-08-31 12:56:51 01039_row_policy_dcl: [ OK ] 1.59 sec.
2024-08-31 12:56:51 01036_union_different_columns: [ OK ] 0.22 sec.
2024-08-31 12:56:52 01035_prewhere_with_alias: [ OK ] 0.23 sec.
2024-08-31 12:56:52 01034_unknown_qualified_column_in_join: [ OK ] 0.22 sec.
2024-08-31 12:56:52 01034_with_fill_and_push_down_predicate: [ OK ] 0.21 sec.
2024-08-31 12:56:52 01034_JSONCompactEachRow: [ OK ] 0.64 sec.
2024-08-31 12:56:53 01034_prewhere_max_parallel_replicas_distributed: [ OK ] 0.25 sec.
2024-08-31 12:56:53 01032_cityHash64_for_decimal: [ OK ] 0.22 sec.
2024-08-31 12:56:53 01032_cityHash64_for_UUID: [ OK ] 0.27 sec.
2024-08-31 12:56:53 01032_duplicate_column_insert_query: [ OK ] 0.27 sec.
2024-08-31 12:56:54 01035_avg: [ OK ] 2.44 sec.
2024-08-31 12:56:54 01062_pm_all_join_with_block_continuation: [ OK ] 12.61 sec.
2024-08-31 12:56:54 01031_pmj_new_any_semi_join: [ OK ] 0.44 sec.
2024-08-31 12:56:54 01034_values_parse_float_bug: [ OK ] 2.84 sec.
2024-08-31 12:56:54 01025_array_compact_generic: [ OK ] 0.26 sec.
2024-08-31 12:56:55 01024__getScalar: [ OK ] 0.21 sec.
2024-08-31 12:56:55 01020_function_array_compact: [ OK ] 0.23 sec.
2024-08-31 12:56:55 01020_having_without_group_by: [ OK ] 0.42 sec.
2024-08-31 12:56:55 01021_only_tuple_columns: [ OK ] 0.87 sec.
2024-08-31 12:56:56 01020_function_char: [ OK ] 0.37 sec.
2024-08-31 12:56:56 01019_array_fill: [ OK ] 0.36 sec.
2024-08-31 12:56:56 01030_limit_by_with_ties_error: [ OK ] 2.63 sec.
2024-08-31 12:56:56 01019_materialized_view_select_extra_columns: [ OK ] 0.57 sec.
2024-08-31 12:56:57 01031_mutations_interpreter_and_context: [ OK ] 3.22 sec.
2024-08-31 12:56:57 01018_ddl_dictionaries_special: [ OK ] 0.62 sec.
2024-08-31 12:56:57 01018_Distributed__shard_num: [ OK ] 0.67 sec.
2024-08-31 12:56:57 01018_ddl_dictionaries_select: [ OK ] 0.95 sec.
2024-08-31 12:56:57 01018_ambiguous_column: [ OK ] 0.27 sec.
2024-08-31 12:56:58 01017_tuplehamming_distance: [ OK ] 0.24 sec.
2024-08-31 12:56:58 01017_bithamming_distance: [ OK ] 0.27 sec.
2024-08-31 12:56:58 01017_in_unconvertible_complex_type: [ OK ] 0.28 sec.
2024-08-31 12:56:58 01016_macros: [ OK ] 0.23 sec.
2024-08-31 12:56:59 01017_uniqCombined_memory_usage: [ OK ] 0.89 sec.
2024-08-31 12:56:59 01015_empty_in_inner_right_join: [ OK ] 0.48 sec.
2024-08-31 12:56:59 01014_count_of_merges_metrics: [ OK ] 0.25 sec.
2024-08-31 12:56:59 01014_function_repeat_corner_cases: [ OK ] 0.33 sec.
2024-08-31 12:56:59 01013_hex_float: [ OK ] 0.23 sec.
2024-08-31 12:57:00 01013_totals_without_aggregation: [ OK ] 0.25 sec.
2024-08-31 12:57:00 01059_storage_file_compression: [ OK ] 18.08 sec.
2024-08-31 12:57:00 01013_hex_decimal: [ OK ] 0.30 sec.
2024-08-31 12:57:00 01119_session_log: [ OK ] 30.72 sec.
2024-08-31 12:57:00 01012_select_limit_x_0: [ OK ] 0.24 sec.
2024-08-31 12:57:00 01011_group_uniq_array_memsan: [ OK ] 0.22 sec.
2024-08-31 12:57:00 01011_test_create_as_skip_indices: [ OK ] 0.27 sec.
2024-08-31 12:57:00 01012_serialize_array_memory_usage: [ OK ] 0.45 sec.
2024-08-31 12:57:01 01010_partial_merge_join_const_and_lc: [ OK ] 0.35 sec.
2024-08-31 12:57:01 01010_pm_join_all_join_bug: [ OK ] 0.26 sec.
2024-08-31 12:57:01 01010_pmj_on_disk: [ OK ] 0.28 sec.
2024-08-31 12:57:01 01009_insert_select_data_loss: [ OK ] 0.25 sec.
2024-08-31 12:57:01 01009_global_array_join_names: [ OK ] 0.29 sec.
2024-08-31 12:57:01 01017_mutations_with_nondeterministic_functions_zookeeper: [ OK ] 3.88 sec.
2024-08-31 12:57:01 01010_pmj_skip_blocks: [ OK ] 0.71 sec.
2024-08-31 12:57:02 01010_partial_merge_join: [ OK ] 0.85 sec.
2024-08-31 12:57:02 01001_enums_in_in_section: [ OK ] 0.24 sec.
2024-08-31 12:57:02 01014_format_custom_separated: [ OK ] 3.39 sec.
2024-08-31 12:57:02 00999_settings_no_extra_quotes: [ OK ] 0.26 sec.
2024-08-31 12:57:03 00999_join_not_nullable_types: [ OK ] 0.24 sec.
2024-08-31 12:57:03 00999_nullable_nested_types_4877: [ OK ] 0.28 sec.
2024-08-31 12:57:03 00999_join_on_expression: [ OK ] 0.32 sec.
2024-08-31 12:57:03 00999_test_skip_indices_with_alter_and_merge: [ OK ] 0.25 sec.
2024-08-31 12:57:03 01000_unneeded_substitutions_client: [ OK ] 1.65 sec.
2024-08-31 12:57:04 00997_extract_all_crash_6627: [ OK ] 0.27 sec.
2024-08-31 12:57:04 00997_trim: [ OK ] 0.61 sec.
2024-08-31 12:57:05 00996_neighbor: [ OK ] 0.54 sec.
2024-08-31 12:57:05 00996_limit_with_ties: [ OK ] 1.39 sec.
2024-08-31 12:57:08 00988_parallel_parts_removal: [ OK ] 2.33 sec.
2024-08-31 12:57:09 00988_constraints_replication_zookeeper_long: [ OK ] 0.97 sec.
2024-08-31 12:57:14 00986_materialized_view_stack_overflow: [ OK ] 4.95 sec.
2024-08-31 12:57:15 01001_rename_merge_race_condition: [ OK ] 13.16 sec.
2024-08-31 12:57:15 01007_r1r2_w_r2r1_deadlock: [ OK ] 14.04 sec.
2024-08-31 12:57:16 01004_rename_deadlock: [ OK ] 14.74 sec.
2024-08-31 12:57:16 00981_no_virtual_columns: [ OK ] 0.67 sec.
2024-08-31 12:57:18 00980_full_join_crash_fancyqlx: [ OK ] 2.02 sec.
2024-08-31 12:57:19 00980_merge_alter_settings: [ OK ] 2.69 sec.
2024-08-31 12:57:20 00980_crash_nullable_decimal: [ OK ] 0.85 sec.
2024-08-31 12:57:21 00978_sum_map_bugfix: [ OK ] 0.82 sec.
2024-08-31 12:57:22 00980_zookeeper_merge_tree_alter_settings: [ OK ] 3.04 sec.
2024-08-31 12:57:22 00978_ml_math: [ OK ] 0.71 sec.
2024-08-31 12:57:23 00976_asof_join_on: [ OK ] 1.01 sec.
2024-08-31 12:57:24 00976_system_stop_ttl_merges: [ OK ] 1.74 sec.
2024-08-31 12:57:25 00975_sample_prewhere_distributed: [ OK ] 1.29 sec.
2024-08-31 12:57:25 00981_topK_topKWeighted_long: [ OK ] 11.18 sec.
2024-08-31 12:57:26 00975_recursive_materialized_view: [ OK ] 0.83 sec.
2024-08-31 12:57:27 00976_max_execution_speed: [ OK ] 3.68 sec.
2024-08-31 12:57:27 00975_json_hang: [ OK ] 1.91 sec.
2024-08-31 12:57:28 00974_full_outer_join: [ OK ] 0.60 sec.
2024-08-31 12:57:28 00974_fix_join_on: [ OK ] 1.57 sec.
2024-08-31 12:57:28 00981_in_subquery_with_tuple: [ OK ] 13.01 sec.
2024-08-31 12:57:29 00974_low_cardinality_cast: [ OK ] 1.03 sec.
2024-08-31 12:57:30 00974_adaptive_granularity_secondary_index: [ OK ] 3.22 sec.
2024-08-31 12:57:31 00971_merge_tree_uniform_read_distribution_and_max_rows_to_read: [ OK ] 0.88 sec.
2024-08-31 12:57:32 00972_geohashesInBox: [ OK ] 3.04 sec.
2024-08-31 12:57:32 00969_columns_clause: [ OK ] 1.03 sec.
2024-08-31 12:57:33 00969_roundDuration: [ OK ] 0.87 sec.
2024-08-31 12:57:33 00968_roundAge: [ OK ] 0.91 sec.
2024-08-31 12:57:34 00973_uniq_non_associativity: [ OK ] 5.44 sec.
2024-08-31 12:57:34 00967_insert_into_distributed_different_types: [ OK ] 0.64 sec.
2024-08-31 12:57:34 00967_ubsan_bit_test: [ OK ] 1.00 sec.
2024-08-31 12:57:35 00966_invalid_json_must_not_parse: [ OK ] 0.85 sec.
2024-08-31 12:57:35 00963_startsWith_force_primary_key: [ OK ] 1.01 sec.
2024-08-31 12:57:36 00960_eval_ml_method_const: [ OK ] 0.63 sec.
2024-08-31 12:57:36 00961_check_table: [ OK ] 1.44 sec.
2024-08-31 12:57:37 00957_delta_diff_bug: [ OK ] 1.40 sec.
2024-08-31 12:57:38 00957_neighbor: [ OK ] 1.41 sec.
2024-08-31 12:57:38 00956_join_use_nulls_with_array_column: [ OK ] 0.39 sec.
2024-08-31 12:57:38 00991_system_parts_race_condition_long: [ OK ] 33.73 sec.
2024-08-31 12:57:39 00974_primary_key_for_lowCardinality: [ OK ] 10.75 sec.
2024-08-31 12:57:39 00956_http_prepared_statements: [ OK ] 1.76 sec.
2024-08-31 12:57:42 00953_indices_alter_exceptions: [ OK ] 2.38 sec.
2024-08-31 12:57:42 00955_complex_prepared_statements: [ OK ] 3.57 sec.
2024-08-31 12:57:42 00952_part_frozen_info: [ OK ] 0.27 sec.
2024-08-31 12:57:42 00952_insert_into_distributed_with_materialized_column: [ OK ] 0.44 sec.
2024-08-31 12:57:42 00953_constraints_operations: [ OK ] 3.77 sec.
2024-08-31 12:57:43 01019_alter_materialized_view_atomic: [ OK ] 46.98 sec.
2024-08-31 12:57:43 00950_test_gorilla_codec: [ OK ] 0.29 sec.
2024-08-31 12:57:43 00954_client_prepared_statements: [ OK ] 4.69 sec.
2024-08-31 12:57:43 00951_ngram_search: [ OK ] 0.75 sec.
2024-08-31 12:57:43 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.19 sec.
2024-08-31 12:57:43 00950_default_prewhere: [ OK ] 0.29 sec.
2024-08-31 12:57:43 00947_ml_test: [ OK ] 0.31 sec.
2024-08-31 12:57:44 00944_ml_test: [ OK ] 0.30 sec.
2024-08-31 12:57:44 00943_mv_rename_without_inner_table: [ OK ] 0.25 sec.
2024-08-31 12:57:44 00942_mv_rename_table: [ OK ] 0.25 sec.
2024-08-31 12:57:45 00964_bloom_index_string_functions: [ OK ] 10.89 sec.
2024-08-31 12:57:45 00940_order_by_read_in_order_query_plan: [ OK ] 0.76 sec.
2024-08-31 12:57:45 00940_max_parts_in_total: [ OK ] 0.26 sec.
2024-08-31 12:57:45 00942_dataparts_500: [ OK ] 1.35 sec.
2024-08-31 12:57:45 00940_order_by_read_in_order: [ OK ] 0.40 sec.
2024-08-31 12:57:45 00939_limit_by_offset: [ OK ] 0.28 sec.
2024-08-31 12:57:45 00945_bloom_filter_index: [ OK ] 2.03 sec.
2024-08-31 12:57:45 01034_move_partition_from_table_zookeeper: [ OK ] 53.42 sec.
2024-08-31 12:57:45 00938_dataset_test: [ OK ] 0.26 sec.
2024-08-31 12:57:45 00938_test_retention_function: [ OK ] 0.29 sec.
2024-08-31 12:57:46 00937_ipv4_cidr_range: [ OK ] 0.28 sec.
2024-08-31 12:57:46 00936_function_result_with_operator_in: [ OK ] 0.33 sec.
2024-08-31 12:57:46 00936_crc_functions: [ OK ] 0.27 sec.
2024-08-31 12:57:47 00952_basic_constraints: [ OK ] 4.29 sec.
2024-08-31 12:57:47 00934_is_valid_utf8: [ OK ] 0.53 sec.
2024-08-31 12:57:47 00932_array_intersect_bug: [ OK ] 0.21 sec.
2024-08-31 12:57:47 00933_alter_ttl: [ OK ] 0.34 sec.
2024-08-31 12:57:47 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 0.32 sec.
2024-08-31 12:57:47 00931_low_cardinality_read_with_empty_array: [ OK ] 0.43 sec.
2024-08-31 12:57:48 00930_arrayIntersect: [ OK ] 0.29 sec.
2024-08-31 12:57:48 00927_asof_join_noninclusive: [ OK ] 0.40 sec.
2024-08-31 12:57:48 00936_substring_utf8_non_const: [ OK ] 2.66 sec.
2024-08-31 12:57:48 00929_multi_match_edit_distance: [ OK ] 0.77 sec.
2024-08-31 12:57:48 00937_format_schema_rows_template: [ OK ] 2.91 sec.
2024-08-31 12:57:48 00927_disable_hyperscan: [ OK ] 0.32 sec.
2024-08-31 12:57:49 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 0.37 sec.
2024-08-31 12:57:49 00926_adaptive_index_granularity_merge_tree: [ OK ] 0.87 sec.
2024-08-31 12:57:49 00917_multiple_joins_denny_crane: [ OK ] 0.29 sec.
2024-08-31 12:57:50 00952_input_function: [ OK ] 7.91 sec.
2024-08-31 12:57:50 00916_add_materialized_column_after: [ OK ] 0.22 sec.
2024-08-31 12:57:50 00914_replicate: [ OK ] 0.23 sec.
2024-08-31 12:57:50 00916_join_using_duplicate_columns: [ OK ] 0.30 sec.
2024-08-31 12:57:50 00937_test_use_header_csv: [ OK ] 4.67 sec.
2024-08-31 12:57:51 00910_zookeeper_test_alter_compression_codecs_long: [ OK ] 0.61 sec.
2024-08-31 12:57:51 00910_crash_when_distributed_modify_order_by: [ OK ] 0.28 sec.
2024-08-31 12:57:51 00913_many_threads: [ OK ] 1.12 sec.
2024-08-31 12:57:51 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 3.04 sec.
2024-08-31 12:57:52 00910_decimal_group_array_crash_3783: [ OK ] 0.63 sec.
2024-08-31 12:57:52 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 2.97 sec.
2024-08-31 12:57:52 00927_asof_join_other_types: [ OK ] 3.80 sec.
2024-08-31 12:57:52 00910_client_window_size_detection: [ OK ] 1.89 sec.
2024-08-31 12:57:52 00909_ngram_distance: [ OK ] 0.78 sec.
2024-08-31 12:57:52 00906_low_cardinality_rollup: [ OK ] 0.26 sec.
2024-08-31 12:57:52 00904_array_with_constant_2: [ OK ] 0.22 sec.
2024-08-31 12:57:52 00905_compile_expressions_compare_big_dates: [ OK ] 0.27 sec.
2024-08-31 12:57:53 00903_array_with_constant_function: [ OK ] 0.22 sec.
2024-08-31 12:57:53 00902_entropy: [ OK ] 0.27 sec.
2024-08-31 12:57:53 00909_arrayEnumerateUniq: [ OK ] 1.14 sec.
2024-08-31 12:57:53 00901_joint_entropy: [ OK ] 0.27 sec.
2024-08-31 12:57:54 00908_long_http_insert: [ OK ] 1.95 sec.
2024-08-31 12:57:56 00900_orc_arrays_load: [ OK ] 2.83 sec.
2024-08-31 12:57:56 00900_null_array_orc_load: [ OK ] 2.43 sec.
2024-08-31 12:57:58 00900_orc_arrow_parquet_maps: [ OK ] 4.80 sec.
2024-08-31 12:57:58 00897_flatten: [ OK ] 0.23 sec.
2024-08-31 12:57:58 00898_parsing_bad_diagnostic_message: [ OK ] 1.75 sec.
2024-08-31 12:57:58 00882_multiple_join_no_alias: [ OK ] 0.25 sec.
2024-08-31 12:57:58 00878_join_unexpected_results: [ OK ] 0.38 sec.
2024-08-31 12:57:59 00876_wrong_arraj_join_column: [ OK ] 0.23 sec.
2024-08-31 12:57:59 00875_join_right_nulls_ors: [ OK ] 0.41 sec.
2024-08-31 12:57:59 00909_kill_not_initialized_query: [ OK ] 8.11 sec.
2024-08-31 12:57:59 00880_decimal_in_key: [ OK ] 1.46 sec.
2024-08-31 12:57:59 00875_join_right_nulls: [ OK ] 0.40 sec.
2024-08-31 12:58:00 00860_unknown_identifier_bug: [ OK ] 0.25 sec.
2024-08-31 12:58:00 00862_decimal_in: [ OK ] 0.30 sec.
2024-08-31 12:58:00 00872_t64_bit_codec: [ OK ] 0.74 sec.
2024-08-31 12:58:00 00856_no_column_issue_4242: [ OK ] 0.25 sec.
2024-08-31 12:58:00 00857_global_joinsavel_table_alias: [ OK ] 0.38 sec.
2024-08-31 12:58:00 00854_multiple_join_asterisks: [ OK ] 0.30 sec.
2024-08-31 12:58:00 00900_orc_arrow_parquet_tuples: [ OK ] 4.65 sec.
2024-08-31 12:58:00 00853_join_with_nulls_crash: [ OK ] 0.37 sec.
2024-08-31 12:58:01 00848_join_use_nulls_segfault: [ OK ] 0.43 sec.
2024-08-31 12:58:01 00847_multiple_join_same_column: [ OK ] 0.37 sec.
2024-08-31 12:58:01 00849_multiple_comma_join_2: [ OK ] 0.67 sec.
2024-08-31 12:58:01 00846_join_using_tuple_crash: [ OK ] 0.24 sec.
2024-08-31 12:58:01 00844_join_lightee2: [ OK ] 0.27 sec.
2024-08-31 12:58:01 00843_optimize_predicate_and_rename_table: [ OK ] 0.29 sec.
2024-08-31 12:58:01 00842_array_with_constant_overflow: [ OK ] 0.23 sec.
2024-08-31 12:58:01 00841_temporary_table_database: [ OK ] 0.24 sec.
2024-08-31 12:58:02 00839_bitmask_negative: [ OK ] 0.27 sec.
2024-08-31 12:58:02 00835_if_generic_case: [ OK ] 0.30 sec.
2024-08-31 12:58:02 00836_indices_alter_replicated_zookeeper_long: [ OK ] 0.58 sec.
2024-08-31 12:58:02 00834_date_datetime_cmp: [ OK ] 0.22 sec.
2024-08-31 12:58:02 00834_limit_with_constant_expressions: [ OK ] 0.35 sec.
2024-08-31 12:58:02 00851_http_insert_json_defaults: [ OK ] 2.27 sec.
2024-08-31 12:58:03 00834_not_between: [ OK ] 0.23 sec.
2024-08-31 12:58:03 00833_sleep_overflow: [ OK ] 0.22 sec.
2024-08-31 12:58:03 00832_storage_file_lock: [ OK ] 0.25 sec.
2024-08-31 12:58:03 00831_quantile_weighted_parameter_check: [ OK ] 0.27 sec.
2024-08-31 12:58:03 00829_bitmap64_function: [ OK ] 0.36 sec.
2024-08-31 12:58:04 00829_bitmap_function: [ OK ] 0.76 sec.
2024-08-31 12:58:04 00826_cross_to_inner_join: [ OK ] 0.44 sec.
2024-08-31 12:58:04 00837_minmax_index: [ OK ] 3.09 sec.
2024-08-31 12:58:04 00908_bloom_filter_index: [ OK ] 12.57 sec.
2024-08-31 12:58:06 00825_protobuf_format_splitted_nested: [ OK ] 2.67 sec.
2024-08-31 12:58:06 00825_protobuf_format_array_3dim: [ OK ] 2.59 sec.
2024-08-31 12:58:07 00825_protobuf_format_skipped_column_in_nested: [ OK ] 2.50 sec.
2024-08-31 12:58:07 00938_fix_rwlock_segfault_long: [ OK ] 21.95 sec.
2024-08-31 12:58:08 00825_http_header_query_id: [ OK ] 1.46 sec.
2024-08-31 12:58:08 00823_capnproto_input: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 12:58:08 00823_sequence_match_dfa: [ OK ] 0.70 sec.
2024-08-31 12:58:08 00821_distributed_storage_with_join_on: [ OK ] 0.29 sec.
2024-08-31 12:58:08 00819_ast_refactoring_bugs: [ OK ] 0.25 sec.
2024-08-31 12:58:08 00820_multiple_joins_subquery_requires_alias: [ OK ] 0.32 sec.
2024-08-31 12:58:09 00814_parsing_ub: [ OK ] 0.21 sec.
2024-08-31 12:58:09 00818_alias_bug_4110: [ OK ] 0.32 sec.
2024-08-31 12:58:09 00811_garbage: [ OK ] 0.25 sec.
2024-08-31 12:58:09 00825_protobuf_format_squares: [ OK ] 2.46 sec.
2024-08-31 12:58:09 00810_in_operators_segfault: [ OK ] 0.23 sec.
2024-08-31 12:58:09 00809_add_days_segfault: [ OK ] 0.31 sec.
2024-08-31 12:58:09 00805_round_down: [ OK ] 0.33 sec.
2024-08-31 12:58:09 00808_not_optimize_predicate: [ OK ] 0.37 sec.
2024-08-31 12:58:09 00825_protobuf_format_nested_in_nested: [ OK ] 2.45 sec.
2024-08-31 12:58:09 00804_rollup_with_having: [ OK ] 0.25 sec.
2024-08-31 12:58:10 00804_test_custom_compression_codes_log_storages: [ OK ] 0.47 sec.
2024-08-31 12:58:10 00803_odbc_driver_2_format: [ OK ] 0.22 sec.
2024-08-31 12:58:10 00804_test_custom_compression_codecs: [ OK ] 0.59 sec.
2024-08-31 12:58:10 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 0.23 sec.
2024-08-31 12:58:10 00800_low_cardinality_empty_array: [ OK ] 0.25 sec.
2024-08-31 12:58:10 00834_kill_mutation_replicated_zookeeper: [ OK ] 7.97 sec.
2024-08-31 12:58:10 00825_protobuf_format_persons: [ OK ] 5.68 sec.
2024-08-31 12:58:10 00800_function_java_hash: [ OK ] 0.30 sec.
2024-08-31 12:58:10 00800_low_cardinality_distributed_insert: [ OK ] 0.26 sec.
2024-08-31 12:58:10 00799_function_dry_run: [ OK ] 0.23 sec.
2024-08-31 12:58:10 00800_versatile_storage_join: [ OK ] 0.34 sec.
2024-08-31 12:58:11 00794_materialized_view_with_column_defaults: [ OK ] 0.31 sec.
2024-08-31 12:58:11 00763_create_query_as_table_engine_bug: [ OK ] 0.23 sec.
2024-08-31 12:58:11 00779_all_right_join_max_block_size: [ OK ] 0.27 sec.
2024-08-31 12:58:11 00800_low_cardinality_merge_join: [ OK ] 1.04 sec.
2024-08-31 12:58:11 00757_enum_defaults_const_analyzer: [ OK ] 0.22 sec.
2024-08-31 12:58:11 00758_array_reverse: [ OK ] 0.27 sec.
2024-08-31 12:58:11 00760_insert_json_with_defaults: [ OK ] 0.31 sec.
2024-08-31 12:58:11 00757_enum_defaults_const: [ OK ] 0.23 sec.
2024-08-31 12:58:11 00753_distributed_system_columns_and_system_tables: [ OK ] 0.25 sec.
2024-08-31 12:58:11 00753_quantile_format: [ OK ] 0.35 sec.
2024-08-31 12:58:11 00754_alter_modify_column_partitions: [ OK ] 0.48 sec.
2024-08-31 12:58:11 00753_alter_destination_for_storage_buffer: [ OK ] 0.34 sec.
2024-08-31 12:58:11 00753_comment_columns_zookeeper: [ OK ] 0.27 sec.
2024-08-31 12:58:12 00752_low_cardinality_array_result: [ OK ] 0.22 sec.
2024-08-31 12:58:12 00752_low_cardinality_left_array_join: [ OK ] 0.26 sec.
2024-08-31 12:58:12 00752_low_cardinality_permute: [ OK ] 0.23 sec.
2024-08-31 12:58:12 00752_low_cardinality_lambda_argument: [ OK ] 0.26 sec.
2024-08-31 12:58:12 00753_alter_attach: [ OK ] 0.76 sec.
2024-08-31 12:58:12 00746_hashing_tuples: [ OK ] 0.27 sec.
2024-08-31 12:58:12 00751_low_cardinality_nullable_group_by: [ OK ] 0.84 sec.
2024-08-31 12:58:13 00745_compile_scalar_subquery: [ OK ] 0.32 sec.
2024-08-31 12:58:13 00743_limit_by_not_found_column: [ OK ] 0.28 sec.
2024-08-31 12:58:13 00742_require_join_strictness: [ OK ] 0.22 sec.
2024-08-31 12:58:13 00740_optimize_predicate_expression: [ OK ] 0.28 sec.
2024-08-31 12:58:13 00740_database_in_nested_view: [ OK ] 0.28 sec.
2024-08-31 12:58:13 00900_long_parquet: [ OK ] 20.47 sec.
2024-08-31 12:58:13 00739_array_element_nullable_string_mattrobenolt: [ OK ] 0.27 sec.
2024-08-31 12:58:13 00738_nested_merge_multidimensional_array: [ OK ] 0.25 sec.
2024-08-31 12:58:14 00737_decimal_group_by: [ OK ] 0.27 sec.
2024-08-31 12:58:14 00804_test_alter_compression_codecs: [ OK ] 4.25 sec.
2024-08-31 12:58:14 00734_timeslot: [ OK ] 0.35 sec.
2024-08-31 12:58:14 00732_quorum_insert_lost_part_and_alive_part_zookeeper_long: [ OK ] 0.41 sec.
2024-08-31 12:58:14 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 0.39 sec.
2024-08-31 12:58:14 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 0.34 sec.
2024-08-31 12:58:14 00732_decimal_summing_merge_tree: [ OK ] 0.26 sec.
2024-08-31 12:58:14 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 0.33 sec.
2024-08-31 12:58:14 00732_base64_functions: [ OK ] 0.42 sec.
2024-08-31 12:58:15 00730_unicode_terminal_format: [ OK ] 0.27 sec.
2024-08-31 12:58:15 00726_materialized_view_concurrent: [ OK ] 0.26 sec.
2024-08-31 12:58:15 00726_length_aliases: [ OK ] 0.20 sec.
2024-08-31 12:58:15 00729_prewhere_array_join: [ OK ] 0.40 sec.
2024-08-31 12:58:15 00725_join_on_bug_4: [ OK ] 0.25 sec.
2024-08-31 12:58:15 00725_join_on_bug_1: [ OK ] 0.26 sec.
2024-08-31 12:58:15 00725_memory_tracking: [ FAIL ] 0.51 sec. - return code: 128
2024-08-31 12:58:15 [bf916cf63af2] 2024.08.31 12:58:15.705237 [ 5331 ] {445b9b53-6803-4718-8797-8f736586bb92} executeQuery: Code: 128. DB::Exception: Array of size 100000000 is too large to be manipulated as single field, maximum size 1000000: In scope SELECT length(range(100000000)). (TOO_LARGE_ARRAY_SIZE) (version 24.3.5.48.altinityfips (altinity build)) (from [::1]:36330) (comment: 00725_memory_tracking.sql) (in query: SELECT length(range(100000000));), Stack trace (when copying this message, always include the lines below):
2024-08-31 12:58:15
2024-08-31 12:58:15 0. std::exception::capture() @ 0x0000000018191275
2024-08-31 12:58:15 1. ./build_docker/./base/poco/Foundation/src/Exception.cpp:28: Poco::Exception::Exception(String const&, int) @ 0x0000000036921c45
2024-08-31 12:58:15 2. ./build_docker/./src/Common/Exception.cpp:96: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x00000000246243cb
2024-08-31 12:58:15 3. DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, unsigned long&, unsigned long const&) @ 0x00000000196c9862
2024-08-31 12:58:15 4. ./build_docker/./src/Columns/ColumnArray.cpp:140: DB::ColumnArray::get(unsigned long, DB::Field&) const @ 0x00000000318ea436
2024-08-31 12:58:15 5. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:0: DB::(anonymous namespace)::QueryAnalyzer::resolveFunction(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&) @ 0x0000000030858519
2024-08-31 12:58:15 6. ./contrib/llvm-project/libcxx/include/vector:543: DB::(anonymous namespace)::QueryAnalyzer::resolveExpressionNode(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&, bool, bool) @ 0x000000003082a0c3
2024-08-31 12:58:15 7. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:6624: DB::(anonymous namespace)::QueryAnalyzer::resolveExpressionNodeList(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&, bool, bool) @ 0x0000000030828c41
2024-08-31 12:58:15 8. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:815: DB::(anonymous namespace)::QueryAnalyzer::resolveFunction(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&) @ 0x000000003084cbdd
2024-08-31 12:58:15 9. ./contrib/llvm-project/libcxx/include/vector:543: DB::(anonymous namespace)::QueryAnalyzer::resolveExpressionNode(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&, bool, bool) @ 0x000000003082a0c3
2024-08-31 12:58:15 10. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:6624: DB::(anonymous namespace)::QueryAnalyzer::resolveExpressionNodeList(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&, bool, bool) @ 0x0000000030828c41
2024-08-31 12:58:15 11. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:815: DB::(anonymous namespace)::QueryAnalyzer::resolveProjectionExpressionNodeList(std::shared_ptr&, DB::(anonymous namespace)::IdentifierResolveScope&) @ 0x000000003083802c
2024-08-31 12:58:15 12. ./contrib/llvm-project/libcxx/include/vector:951: DB::(anonymous namespace)::QueryAnalyzer::resolveQuery(std::shared_ptr const&, DB::(anonymous namespace)::IdentifierResolveScope&) @ 0x00000000308160aa
2024-08-31 12:58:15 13. ./build_docker/./src/Analyzer/Passes/QueryAnalysisPass.cpp:1148: DB::QueryAnalysisPass::run(std::shared_ptr&, std::shared_ptr) @ 0x00000000308126dd
2024-08-31 12:58:15 14. ./build_docker/./src/Analyzer/QueryTreePassManager.cpp:0: DB::QueryTreePassManager::run(std::shared_ptr) @ 0x000000003080b226
2024-08-31 12:58:15 15. ./build_docker/./src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:0: DB::(anonymous namespace)::buildQueryTreeAndRunPasses(std::shared_ptr const&, DB::SelectQueryOptions const&, std::shared_ptr const&, std::shared_ptr const&) @ 0x0000000030fa81f6
2024-08-31 12:58:15 16. ./build_docker/./src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:160: DB::InterpreterSelectQueryAnalyzer::InterpreterSelectQueryAnalyzer(std::shared_ptr const&, std::shared_ptr const&, DB::SelectQueryOptions const&, std::vector> const&) @ 0x0000000030fa5303
2024-08-31 12:58:15 17. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:0: std::__unique_if::__unique_single std::make_unique[abi:v15000]&, std::shared_ptr const&, DB::SelectQueryOptions const&>(std::shared_ptr&, std::shared_ptr const&, DB::SelectQueryOptions const&) @ 0x0000000030faab58
2024-08-31 12:58:15 18. ./contrib/llvm-project/libcxx/include/__memory/compressed_pair.h:40: std::unique_ptr> std::__function::__policy_invoker> (DB::InterpreterFactory::Arguments const&)>::__call_impl> (DB::InterpreterFactory::Arguments const&)>>(std::__function::__policy_storage const*, DB::InterpreterFactory::Arguments const&) @ 0x0000000030fa9d68
2024-08-31 12:58:15 19. ./contrib/llvm-project/libcxx/include/__functional/function.h:818: ? @ 0x0000000030ec7463
2024-08-31 12:58:15 20. ./build_docker/./src/Interpreters/executeQuery.cpp:0: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x000000003169c9b9
2024-08-31 12:58:15 21. ./build_docker/./src/Interpreters/executeQuery.cpp:1374: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x0000000031695ea7
2024-08-31 12:58:15 22. ./build_docker/./src/Server/TCPHandler.cpp:0: DB::TCPHandler::runImpl() @ 0x00000000334396c6
2024-08-31 12:58:15 23. ./build_docker/./src/Server/TCPHandler.cpp:2331: DB::TCPHandler::run() @ 0x0000000033473c16
2024-08-31 12:58:15 24. ./build_docker/./base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x00000000367670fe
2024-08-31 12:58:15 25. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: Poco::Net::TCPServerDispatcher::run() @ 0x000000003676821a
2024-08-31 12:58:15 26. ./build_docker/./base/poco/Foundation/src/ThreadPool.cpp:202: Poco::PooledThread::run() @ 0x00000000369d4030
2024-08-31 12:58:15 27. ./base/poco/Foundation/include/Poco/AutoPtr.h:205: Poco::ThreadImpl::runnableEntry(void*) @ 0x00000000369cf131
2024-08-31 12:58:15 28. ? @ 0x00007fb60a3b4ac3
2024-08-31 12:58:15 29. ? @ 0x00007fb60a446850
2024-08-31 12:58:15
2024-08-31 12:58:15 Received exception from server (version 24.3.5):
2024-08-31 12:58:15 Code: 128. DB::Exception: Received from localhost:9000. DB::Exception: Array of size 100000000 is too large to be manipulated as single field, maximum size 1000000: In scope SELECT length(range(100000000)). (TOO_LARGE_ARRAY_SIZE)
2024-08-31 12:58:15 (query: SELECT length(range(100000000));)
2024-08-31 12:58:15 , result:
2024-08-31 12:58:15
2024-08-31 12:58:15 0
2024-08-31 12:58:15
2024-08-31 12:58:15 stdout:
2024-08-31 12:58:15 0
2024-08-31 12:58:15
2024-08-31 12:58:15
2024-08-31 12:58:15 Settings used in the test: --max_insert_threads 8 --group_by_two_level_threshold 141230 --group_by_two_level_threshold_bytes 1 --distributed_aggregation_memory_efficient 0 --fsync_metadata 0 --output_format_parallel_formatting 1 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 6471261 --max_read_buffer_size 586200 --prefer_localhost_replica 1 --max_block_size 8422 --max_threads 7 --optimize_append_index 1 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 1 --optimize_or_like_chain 0 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 18 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 31191374 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 9176414556 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method pread_threadpool --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 0 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 128Mi --filesystem_prefetches_limit 0 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 8 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 348621586 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 1323025284 --min_compress_block_size 1663043 --max_compress_block_size 2358317 --merge_tree_compact_parts_min_granules_to_multibuffer_read 30 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 8460598 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone Africa/Juba --prefer_warmed_unmerged_parts_seconds 9 --use_page_cache_for_disks_without_file_cache False --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.57
2024-08-31 12:58:15
2024-08-31 12:58:15 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 6179287411 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 1651140311 --index_granularity_bytes 9934501 --merge_max_block_size 10487 --index_granularity 38468 --min_bytes_for_wide_part 285592871 --marks_compress_block_size 29570 --primary_key_compress_block_size 27054 --replace_long_file_name_to_hash 0 --max_file_name_length 0 --min_bytes_for_full_part_storage 469688828 --compact_parts_max_bytes_to_buffer 231824184 --compact_parts_max_granules_to_buffer 1 --compact_parts_merge_max_bytes_to_prefetch_part 4444277 --cache_populated_by_fetch 0
2024-08-31 12:58:15
2024-08-31 12:58:15 Database: test_sk3cyvka
2024-08-31 12:58:15 00725_join_on_bug_2: [ OK ] 0.30 sec.
2024-08-31 12:58:15 00725_join_on_bug_3: [ OK ] 0.24 sec.
2024-08-31 12:58:16 00720_with_cube: [ OK ] 0.31 sec.
2024-08-31 12:58:16 00723_remerge_sort: [ OK ] 0.49 sec.
2024-08-31 12:58:16 00738_lock_for_inner_table: [ OK ] 2.87 sec.
2024-08-31 12:58:16 00714_alter_uuid: [ OK ] 0.34 sec.
2024-08-31 12:58:16 00717_merge_and_distributed: [ OK ] 0.74 sec.
2024-08-31 12:58:17 00712_prewhere_with_alias_bug_2: [ OK ] 0.22 sec.
2024-08-31 12:58:17 00712_prewhere_with_alias_bug: [ OK ] 0.24 sec.
2024-08-31 12:58:17 00712_nan_comparison: [ OK ] 0.30 sec.
2024-08-31 12:58:17 00712_prewhere_with_alias: [ OK ] 0.32 sec.
2024-08-31 12:58:17 00712_prewhere_with_final: [ OK ] 0.25 sec.
2024-08-31 12:58:17 00709_virtual_column_partition_id: [ OK ] 0.26 sec.
2024-08-31 12:58:17 00701_join_default_strictness: [ OK ] 0.26 sec.
2024-08-31 12:58:18 00719_insert_block_without_column: [ OK ] 2.34 sec.
2024-08-31 12:58:18 00702_join_on_dups: [ OK ] 0.52 sec.
2024-08-31 12:58:18 00746_compile_non_deterministic_function: [ OK ] 6.25 sec.
2024-08-31 12:58:18 00700_decimal_with_default_precision_and_scale: [ OK ] 0.25 sec.
2024-08-31 12:58:19 00700_decimal_casts: [ OK ] 1.08 sec.
2024-08-31 12:58:19 00700_decimal_formats: [ OK ] 0.32 sec.
2024-08-31 12:58:19 00700_to_decimal_or_something: [ OK ] 1.20 sec.
2024-08-31 12:58:19 00700_decimal_complex_types: [ OK ] 1.65 sec.
2024-08-31 12:58:20 00700_decimal_math: [ OK ] 0.48 sec.
2024-08-31 12:58:20 00700_decimal_null: [ OK ] 0.34 sec.
2024-08-31 12:58:20 00700_decimal_arithm: [ OK ] 1.91 sec.
2024-08-31 12:58:20 00700_decimal_in_keys: [ OK ] 0.31 sec.
2024-08-31 12:58:20 00700_decimal_defaults: [ OK ] 0.22 sec.
2024-08-31 12:58:20 00700_to_decimal_or_something_1: [ OK ] 1.30 sec.
2024-08-31 12:58:20 00700_decimal_empty_aggregates: [ OK ] 0.74 sec.
2024-08-31 12:58:20 00698_validate_array_sizes_for_nested: [ OK ] 0.24 sec.
2024-08-31 12:58:21 00700_decimal_aggregates: [ OK ] 0.81 sec.
2024-08-31 12:58:21 00695_pretty_max_column_pad_width: [ OK ] 0.21 sec.
2024-08-31 12:58:21 00697_in_subquery_shard: [ OK ] 0.50 sec.
2024-08-31 12:58:21 00696_system_columns_limit: [ OK ] 0.31 sec.
2024-08-31 12:58:21 00694_max_block_size_zero: [ OK ] 0.24 sec.
2024-08-31 12:58:21 00688_aggregation_retention: [ OK ] 0.29 sec.
2024-08-31 12:58:21 00688_low_cardinality_defaults: [ OK ] 0.23 sec.
2024-08-31 12:58:21 00688_low_cardinality_syntax: [ OK ] 0.42 sec.
2024-08-31 12:58:21 00715_fetch_merged_or_mutated_part_zookeeper: [ OK ] 5.59 sec.
2024-08-31 12:58:21 00688_low_cardinality_alter_add_column: [ OK ] 0.23 sec.
2024-08-31 12:58:21 00688_low_cardinality_in: [ OK ] 0.26 sec.
2024-08-31 12:58:22 00687_insert_into_mv: [ OK ] 0.26 sec.
2024-08-31 12:58:22 00685_output_format_json_escape_forward_slashes: [ OK ] 0.21 sec.
2024-08-31 12:58:22 00688_low_cardinality_dictionary_deserialization: [ OK ] 1.05 sec.
2024-08-31 12:58:22 00681_duplicate_columns_inside_union_all_stas_sviridov: [ OK ] 0.24 sec.
2024-08-31 12:58:22 00680_duplicate_columns_inside_union_all: [ OK ] 0.24 sec.
2024-08-31 12:58:22 00679_replace_asterisk: [ OK ] 0.22 sec.
2024-08-31 12:58:22 00679_uuid_in_key: [ OK ] 0.25 sec.
2024-08-31 12:58:22 00676_group_by_in: [ OK ] 0.23 sec.
2024-08-31 12:58:22 00678_shard_funnel_window: [ OK ] 0.41 sec.
2024-08-31 12:58:22 00674_has_array_enum: [ OK ] 0.20 sec.
2024-08-31 12:58:23 00672_arrayDistinct: [ OK ] 0.23 sec.
2024-08-31 12:58:23 00674_join_on_syntax: [ OK ] 0.59 sec.
2024-08-31 12:58:23 00686_client_exit_code: [ OK ] 1.52 sec.
2024-08-31 12:58:23 00668_compare_arrays_silviucpp: [ OK ] 0.24 sec.
2024-08-31 12:58:23 00667_compare_arrays_of_different_types: [ OK ] 0.22 sec.
2024-08-31 12:58:23 00665_alter_nullable_string_to_nullable_uint8: [ OK ] 0.27 sec.
2024-08-31 12:58:23 00662_has_nullable: [ OK ] 0.28 sec.
2024-08-31 12:58:23 00688_low_cardinality_serialization: [ OK ] 2.20 sec.
2024-08-31 12:58:23 00666_uniq_complex_types: [ OK ] 0.40 sec.
2024-08-31 12:58:23 00661_array_has_silviucpp: [ OK ] 0.23 sec.
2024-08-31 12:58:24 00662_array_has_nullable: [ OK ] 0.35 sec.
2024-08-31 12:58:24 00653_monotonic_integer_cast: [ OK ] 0.25 sec.
2024-08-31 12:58:24 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 0.45 sec.
2024-08-31 12:58:25 00673_subquery_prepared_set_performance: [ OK ] 2.22 sec.
2024-08-31 12:58:26 00652_replicated_mutations_default_database_zookeeper: [ OK ] 2.38 sec.
2024-08-31 12:58:26 00650_array_enumerate_uniq_with_tuples: [ OK ] 0.28 sec.
2024-08-31 12:58:27 00649_quantile_tdigest_negative: [ OK ] 0.22 sec.
2024-08-31 12:58:27 00647_select_numbers_with_offset: [ OK ] 0.23 sec.
2024-08-31 12:58:27 00647_multiply_aggregation_state: [ OK ] 0.43 sec.
2024-08-31 12:58:28 00647_histogram: [ OK ] 0.31 sec.
2024-08-31 12:58:28 00639_startsWith: [ OK ] 0.29 sec.
2024-08-31 12:58:28 00763_long_lock_buffer_alter_destination_table: [ OK ] 18.03 sec.
2024-08-31 12:58:30 00637_sessions_in_http_interface_and_settings: [ OK ] 1.52 sec.
2024-08-31 12:58:30 00650_csv_with_specified_quote_rule: [ OK ] 5.04 sec.
2024-08-31 12:58:30 00632_aggregation_window_funnel: [ OK ] 0.64 sec.
2024-08-31 12:58:31 00628_in_lambda_on_merge_table_bug: [ OK ] 0.30 sec.
2024-08-31 12:58:31 00627_recursive_alias: [ OK ] 0.22 sec.
2024-08-31 12:58:33 00652_replicated_mutations_zookeeper: [ OK ] 9.72 sec.
2024-08-31 12:58:34 00626_replace_partition_from_table: [ OK ] 0.51 sec.
2024-08-31 12:58:34 00652_mutations_alter_update: [ OK ] 10.08 sec.
2024-08-31 12:58:34 00625_arrays_in_nested: [ OK ] 0.36 sec.
2024-08-31 12:58:34 00623_truncate_table: [ OK ] 0.41 sec.
2024-08-31 12:58:35 00623_in_partition_key: [ OK ] 0.44 sec.
2024-08-31 12:58:35 00623_replicated_truncate_table_zookeeper_long: [ OK ] 0.36 sec.
2024-08-31 12:58:35 00633_materialized_view_and_too_many_parts_zookeeper: [ OK ] 6.30 sec.
2024-08-31 12:58:35 00622_select_in_parens: [ OK ] 0.26 sec.
2024-08-31 12:58:35 00621_regression_for_in_operator: [ OK ] 0.31 sec.
2024-08-31 12:58:35 00620_optimize_on_nonleader_replica_zookeeper: [ OK ] 0.36 sec.
2024-08-31 12:58:35 00619_extract: [ OK ] 0.26 sec.
2024-08-31 12:58:35 00619_union_highlite: [ OK ] 0.23 sec.
2024-08-31 12:58:35 00618_nullable_in: [ OK ] 0.24 sec.
2024-08-31 12:58:35 00653_verification_monotonic_data_load: [ OK ] 12.10 sec.
2024-08-31 12:58:35 00617_array_in: [ OK ] 0.26 sec.
2024-08-31 12:58:35 00616_final_single_part: [ OK ] 0.30 sec.
2024-08-31 12:58:36 00613_shard_distributed_max_execution_time: [ OK ] 0.24 sec.
2024-08-31 12:58:36 00612_union_query_with_subquery: [ OK ] 0.23 sec.
2024-08-31 12:58:36 00612_http_max_query_size_for_distributed: [ OK ] 0.26 sec.
2024-08-31 12:58:36 00612_count: [ OK ] 0.44 sec.
2024-08-31 12:58:36 00610_materialized_view_forward_alter_partition_statements: [ OK ] 0.26 sec.
2024-08-31 12:58:36 00609_distributed_with_case_when_then: [ OK ] 0.29 sec.
2024-08-31 12:58:36 00608_uniq_array: [ OK ] 0.25 sec.
2024-08-31 12:58:36 00609_prewhere_and_default: [ OK ] 0.57 sec.
2024-08-31 12:58:36 00606_quantiles_and_nans: [ OK ] 0.25 sec.
2024-08-31 12:58:36 00607_index_in_in: [ OK ] 0.31 sec.
2024-08-31 12:58:37 00605_intersections_aggregate_functions: [ OK ] 0.24 sec.
2024-08-31 12:58:37 00604_show_create_database: [ OK ] 0.23 sec.
2024-08-31 12:58:37 00603_system_parts_nonexistent_database: [ OK ] 0.27 sec.
2024-08-31 12:58:37 00600_create_temporary_table_if_not_exists: [ OK ] 0.27 sec.
2024-08-31 12:58:37 00594_alias_in_distributed: [ OK ] 0.49 sec.
2024-08-31 12:58:38 00593_union_all_assert_columns_removed: [ OK ] 0.27 sec.
2024-08-31 12:58:38 00591_columns_removal_union_all: [ OK ] 0.23 sec.
2024-08-31 12:58:38 00601_kill_running_query: [ OK ] 1.54 sec.
2024-08-31 12:58:38 00590_limit_by_column_removal: [ OK ] 0.26 sec.
2024-08-31 12:58:39 00596_limit_on_expanded_ast: [ OK ] 1.76 sec.
2024-08-31 12:58:39 00589_removal_unused_columns_aggregation: [ OK ] 0.37 sec.
2024-08-31 12:58:39 00586_removing_unused_columns_from_subquery: [ OK ] 0.33 sec.
2024-08-31 12:58:39 00612_pk_in_tuple_perf: [ OK ] 3.09 sec.
2024-08-31 12:58:39 00580_cast_nullable_to_non_nullable: [ OK ] 0.21 sec.
2024-08-31 12:58:39 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.26 sec.
2024-08-31 12:58:39 00585_union_all_subquery_aggregation_column_removal: [ OK ] 0.34 sec.
2024-08-31 12:58:39 00580_consistent_hashing_functions: [ OK ] 0.24 sec.
2024-08-31 12:58:39 00578_merge_table_sampling: [ OK ] 0.30 sec.
2024-08-31 12:58:39 00577_full_join_segfault: [ OK ] 0.26 sec.
2024-08-31 12:58:39 00578_merge_table_and_table_virtual_column: [ OK ] 0.36 sec.
2024-08-31 12:58:39 00570_empty_array_is_const: [ OK ] 0.24 sec.
2024-08-31 12:58:39 00569_parse_date_time_best_effort: [ OK ] 0.24 sec.
2024-08-31 12:58:39 00568_empty_function_with_fixed_string: [ OK ] 0.25 sec.
2024-08-31 12:58:40 00566_enum_min_max: [ OK ] 0.23 sec.
2024-08-31 12:58:40 00564_temporary_table_management: [ OK ] 0.22 sec.
2024-08-31 12:58:40 00564_initial_column_values_with_default_expression: [ OK ] 0.26 sec.
2024-08-31 12:58:40 00563_shard_insert_into_remote: [ OK ] 0.25 sec.
2024-08-31 12:58:40 00560_float_leading_plus_in_exponent: [ OK ] 0.25 sec.
2024-08-31 12:58:40 00559_filter_array_generic: [ OK ] 0.25 sec.
2024-08-31 12:58:40 00558_aggregate_merge_totals_with_arenas: [ OK ] 0.25 sec.
2024-08-31 12:58:40 00558_parse_floats: [ OK ] 0.25 sec.
2024-08-31 12:58:41 00556_array_intersect: [ OK ] 0.25 sec.
2024-08-31 12:58:41 00555_right_join_excessive_rows: [ OK ] 0.23 sec.
2024-08-31 12:58:41 00553_buff_exists_materlized_column: [ OK ] 0.25 sec.
2024-08-31 12:58:41 00554_nested_and_table_engines: [ OK ] 0.42 sec.
2024-08-31 12:58:41 00552_logical_functions_uint8_as_bool: [ OK ] 0.22 sec.
2024-08-31 12:58:41 00552_logical_functions_simple: [ OK ] 0.27 sec.
2024-08-31 12:58:41 00632_get_sample_block_cache: [ OK ] 11.75 sec.
2024-08-31 12:58:41 00552_or_nullable: [ OK ] 0.25 sec.
2024-08-31 12:58:42 00551_parse_or_null: [ OK ] 0.23 sec.
2024-08-31 12:58:42 00545_weird_aggregate_functions: [ OK ] 0.21 sec.
2024-08-31 12:58:42 00574_empty_strings_deserialization: [ OK ] 2.84 sec.
2024-08-31 12:58:42 00542_access_to_temporary_table_in_readonly_mode: [ OK ] 0.23 sec.
2024-08-31 12:58:42 00538_datediff_plural_units: [ OK ] 0.23 sec.
2024-08-31 12:58:42 00538_datediff: [ OK ] 0.37 sec.
2024-08-31 12:58:42 00535_parse_float_scientific: [ OK ] 0.22 sec.
2024-08-31 12:58:43 00550_join_insert_select: [ OK ] 1.88 sec.
2024-08-31 12:58:43 00534_exp10: [ OK ] 0.22 sec.
2024-08-31 12:58:46 00564_versioned_collapsing_merge_tree: [ OK ] 6.78 sec.
2024-08-31 12:58:46 00540_bad_data_types: [ OK ] 4.64 sec.
2024-08-31 12:58:47 00534_functions_bad_arguments2: [ OK ] 4.85 sec.
2024-08-31 12:58:47 00534_functions_bad_arguments7: [ OK ] 5.10 sec.
2024-08-31 12:58:49 00534_functions_bad_arguments12: [ OK ] 5.34 sec.
2024-08-31 12:58:49 00530_arrays_of_nothing: [ OK ] 0.24 sec.
2024-08-31 12:58:49 00527_totals_having_nullable: [ OK ] 0.21 sec.
2024-08-31 12:58:50 00523_aggregate_functions_in_group_array: [ OK ] 0.20 sec.
2024-08-31 12:58:51 00534_functions_bad_arguments1: [ OK ] 4.31 sec.
2024-08-31 12:58:51 00522_multidimensional: [ OK ] 1.22 sec.
2024-08-31 12:58:51 00521_multidimensional: [ OK ] 0.37 sec.
2024-08-31 12:58:51 00534_functions_bad_arguments4_long: [ OK ] 4.97 sec.
2024-08-31 12:58:51 00520_tuple_values_interpreter: [ OK ] 0.24 sec.
2024-08-31 12:58:52 00516_deduplication_after_drop_partition_zookeeper: [ OK ] 0.37 sec.
2024-08-31 12:58:52 00517_date_parsing: [ OK ] 0.44 sec.
2024-08-31 12:58:52 00515_shard_desc_table_functions_and_subqueries: [ OK ] 0.27 sec.
2024-08-31 12:58:52 00520_http_nullable: [ OK ] 1.35 sec.
2024-08-31 12:58:52 00514_interval_operators: [ OK ] 0.32 sec.
2024-08-31 12:58:52 00515_enhanced_time_zones: [ OK ] 0.68 sec.
2024-08-31 12:58:52 00513_fractional_time_zones: [ OK ] 0.20 sec.
2024-08-31 12:58:53 00508_materialized_view_to: [ OK ] 0.27 sec.
2024-08-31 12:58:53 00506_shard_global_in_union: [ OK ] 0.45 sec.
2024-08-31 12:58:53 00534_functions_bad_arguments8: [ OK ] 5.90 sec.
2024-08-31 12:58:53 00503_cast_const_nullable: [ OK ] 0.23 sec.
2024-08-31 12:58:53 00506_union_distributed: [ OK ] 0.64 sec.
2024-08-31 12:58:53 00502_string_concat_with_array: [ OK ] 0.20 sec.
2024-08-31 12:58:53 00502_sum_map: [ OK ] 0.43 sec.
2024-08-31 12:58:54 00499_json_enum_insert: [ OK ] 0.23 sec.
2024-08-31 12:58:54 00500_point_in_polygon: [ OK ] 0.43 sec.
2024-08-31 12:58:54 00500_point_in_polygon_non_const_poly: [ OK ] 0.62 sec.
2024-08-31 12:58:54 00495_reading_const_zero_column: [ OK ] 0.23 sec.
2024-08-31 12:58:54 00534_functions_bad_arguments11: [ OK ] 6.59 sec.
2024-08-31 12:58:54 00492_drop_temporary_table: [ OK ] 0.23 sec.
2024-08-31 12:58:54 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.23 sec.
2024-08-31 12:58:54 00488_column_name_primary: [ OK ] 0.23 sec.
2024-08-31 12:58:54 00507_array_no_params: [ OK ] 2.01 sec.
2024-08-31 12:58:54 00487_if_array_fixed_string: [ OK ] 0.22 sec.
2024-08-31 12:58:55 00477_parsing_data_types: [ OK ] 0.17 sec.
2024-08-31 12:58:55 00483_reading_from_array_structure: [ OK ] 0.29 sec.
2024-08-31 12:58:55 00482_subqueries_and_aliases: [ OK ] 0.24 sec.
2024-08-31 12:58:55 00472_create_view_if_not_exists: [ OK ] 0.20 sec.
2024-08-31 12:58:55 00476_pretty_formats_and_widths: [ OK ] 0.23 sec.
2024-08-31 12:58:55 00484_preferred_max_column_in_block_size_bytes: [ OK ] 0.70 sec.
2024-08-31 12:58:55 00471_sql_style_quoting: [ OK ] 0.23 sec.
2024-08-31 12:58:55 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.24 sec.
2024-08-31 12:58:55 00626_replace_partition_from_table_zookeeper: [ OK ] 24.29 sec.
2024-08-31 12:58:55 00467_qualified_names: [ OK ] 0.26 sec.
2024-08-31 12:58:55 00464_array_element_out_of_range: [ OK ] 0.21 sec.
2024-08-31 12:58:55 00465_nullable_default: [ OK ] 0.22 sec.
2024-08-31 12:58:55 00462_json_true_false_literals: [ OK ] 0.24 sec.
2024-08-31 12:58:55 00460_vertical_and_totals_extremes: [ OK ] 0.24 sec.
2024-08-31 12:58:55 00459_group_array_insert_at: [ OK ] 0.23 sec.
2024-08-31 12:58:56 00453_top_k: [ OK ] 0.22 sec.
2024-08-31 12:58:56 00457_log_tinylog_stripelog_nullable: [ OK ] 0.37 sec.
2024-08-31 12:58:56 00458_merge_type_cast: [ OK ] 0.47 sec.
2024-08-31 12:58:56 00453_cast_enum: [ OK ] 0.25 sec.
2024-08-31 12:58:56 00450_higher_order_and_nullable: [ OK ] 0.20 sec.
2024-08-31 12:58:56 00448_to_string_cut_to_zero: [ OK ] 0.22 sec.
2024-08-31 12:58:56 00449_filter_array_nullable_tuple: [ OK ] 0.26 sec.
2024-08-31 12:58:56 00447_foreach_modifier: [ OK ] 0.28 sec.
2024-08-31 12:58:56 00445_join_nullable_keys: [ OK ] 0.24 sec.
2024-08-31 12:58:56 00444_join_use_nulls: [ OK ] 0.25 sec.
2024-08-31 12:58:56 00440_nulls_merge_tree: [ OK ] 0.24 sec.
2024-08-31 12:58:56 00441_nulls_in: [ OK ] 0.29 sec.
2024-08-31 12:58:57 00439_fixed_string_filter: [ OK ] 0.23 sec.
2024-08-31 12:58:57 00437_nulls_first_last: [ OK ] 0.38 sec.
2024-08-31 12:58:57 00434_tonullable: [ OK ] 0.23 sec.
2024-08-31 12:58:57 00473_output_format_json_quote_denormals: [ OK ] 2.53 sec.
2024-08-31 12:58:57 00432_aggregate_function_scalars_and_constants: [ OK ] 0.38 sec.
2024-08-31 12:58:57 00429_point_in_ellipses: [ OK ] 0.23 sec.
2024-08-31 12:58:58 00422_hash_function_constexpr: [ OK ] 0.21 sec.
2024-08-31 12:58:58 00426_nulls_sorting: [ OK ] 0.27 sec.
2024-08-31 12:58:58 00431_if_nulls: [ OK ] 0.60 sec.
2024-08-31 12:58:58 00497_whitespaces_in_insert: [ OK ] 4.24 sec.
2024-08-31 12:58:59 00416_pocopatch_progress_in_http_headers: [ OK ] 1.45 sec.
2024-08-31 12:59:01 00411_long_accurate_number_comparison_int4: [ OK ] 3.12 sec.
2024-08-31 12:59:01 00417_kill_query: [ OK ] 3.75 sec.
2024-08-31 12:59:02 00443_optimize_final_vertical_merge: [ OK ] 5.54 sec.
2024-08-31 12:59:02 00411_merge_tree_where_const_in_set: [ OK ] 0.27 sec.
2024-08-31 12:59:02 00409_shard_limit_by: [ OK ] 0.33 sec.
2024-08-31 12:59:02 00405_output_format_pretty_color: [ OK ] 0.35 sec.
2024-08-31 12:59:02 00404_null_literal: [ OK ] 0.24 sec.
2024-08-31 12:59:02 00402_nan_and_extremes: [ OK ] 0.22 sec.
2024-08-31 12:59:02 00396_uuid: [ OK ] 0.24 sec.
2024-08-31 12:59:04 00746_sql_fuzzy: [ OK ] 52.38 sec.
2024-08-31 12:59:04 00395_nullable: [ OK ] 2.07 sec.
2024-08-31 12:59:05 00394_new_nested_column_keeps_offsets: [ OK ] 0.30 sec.
2024-08-31 12:59:05 00400_client_external_options: [ OK ] 2.37 sec.
2024-08-31 12:59:05 00389_concat_operator: [ OK ] 0.21 sec.
2024-08-31 12:59:05 00393_if_with_constant_condition: [ OK ] 0.25 sec.
2024-08-31 12:59:05 00392_enum_nested_alter: [ OK ] 0.45 sec.
2024-08-31 12:59:05 00384_column_aggregate_function_insert_from: [ OK ] 0.29 sec.
2024-08-31 12:59:06 00387_use_client_time_zone: [ OK ] 1.59 sec.
2024-08-31 12:59:07 00380_client_break_at_exception_in_batch_mode: [ OK ] 1.64 sec.
2024-08-31 12:59:07 00373_group_by_tuple: [ OK ] 0.23 sec.
2024-08-31 12:59:08 00411_long_accurate_number_comparison_int1: [ OK ] 8.54 sec.
2024-08-31 12:59:08 00421_storage_merge__table_index: [ OK ] 10.12 sec.
2024-08-31 12:59:08 00379_system_processes_port: [ OK ] 1.42 sec.
2024-08-31 12:59:08 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 12.03 sec.
2024-08-31 12:59:08 00370_duplicate_columns_in_subqueries: [ OK ] 0.26 sec.
2024-08-31 12:59:08 00369_int_div_of_float: [ OK ] 0.22 sec.
2024-08-31 12:59:08 00362_great_circle_distance: [ OK ] 0.23 sec.
2024-08-31 12:59:08 00361_shared_array_offsets_and_squash_blocks: [ OK ] 0.29 sec.
2024-08-31 12:59:08 00360_to_date_from_string_with_datetime: [ OK ] 0.26 sec.
2024-08-31 12:59:08 00358_from_string_complex_types: [ OK ] 0.23 sec.
2024-08-31 12:59:09 00372_cors_header: [ OK ] 1.41 sec.
2024-08-31 12:59:09 00357_to_string_complex_types: [ OK ] 0.26 sec.
2024-08-31 12:59:09 00356_analyze_aggregations_and_union_all: [ OK ] 0.21 sec.
2024-08-31 12:59:09 00411_long_accurate_number_comparison_int2: [ OK ] 7.80 sec.
2024-08-31 12:59:09 00355_array_of_non_const_convertible_types: [ OK ] 0.20 sec.
2024-08-31 12:59:09 00353_join_by_tuple: [ OK ] 0.24 sec.
2024-08-31 12:59:09 00351_select_distinct_arrays_tuples: [ OK ] 0.25 sec.
2024-08-31 12:59:09 00348_tuples: [ OK ] 0.28 sec.
2024-08-31 12:59:09 00346_if_tuple: [ OK ] 0.22 sec.
2024-08-31 12:59:09 00341_squashing_insert_select2: [ OK ] 0.32 sec.
2024-08-31 12:59:09 00368_format_option_collision: [ OK ] 1.66 sec.
2024-08-31 12:59:10 00338_replicate_array_of_strings: [ OK ] 0.27 sec.
2024-08-31 12:59:10 00337_shard_any_heavy: [ OK ] 0.26 sec.
2024-08-31 12:59:10 00340_squashing_insert_select: [ OK ] 0.85 sec.
2024-08-31 12:59:10 00334_column_aggregate_function_limit: [ OK ] 0.26 sec.
2024-08-31 12:59:10 00331_final_and_prewhere: [ OK ] 0.26 sec.
2024-08-31 12:59:10 00324_hashing_enums: [ OK ] 0.21 sec.
2024-08-31 12:59:11 00339_parsing_bad_arrays: [ OK ] 1.46 sec.
2024-08-31 12:59:11 00365_statistics_in_formats: [ OK ] 2.82 sec.
2024-08-31 12:59:11 00354_host_command_line_option: [ OK ] 2.08 sec.
2024-08-31 12:59:11 00320_between: [ OK ] 0.23 sec.
2024-08-31 12:59:11 00321_pk_set: [ OK ] 0.29 sec.
2024-08-31 12:59:11 00335_bom: [ OK ] 1.42 sec.
2024-08-31 12:59:11 00318_pk_tuple_order: [ OK ] 0.38 sec.
2024-08-31 12:59:11 00315_quantile_off_by_one: [ OK ] 0.22 sec.
2024-08-31 12:59:11 00308_write_buffer_valid_utf8: [ OK ] 0.21 sec.
2024-08-31 12:59:11 00311_array_primary_key: [ OK ] 0.27 sec.
2024-08-31 12:59:12 00307_format_xml: [ OK ] 0.22 sec.
2024-08-31 12:59:12 00300_csv: [ OK ] 0.22 sec.
2024-08-31 12:59:12 00298_enum_width_and_cast: [ OK ] 0.27 sec.
2024-08-31 12:59:12 00322_disable_checksumming: [ OK ] 1.41 sec.
2024-08-31 12:59:12 00299_stripe_log_multiple_inserts: [ OK ] 0.35 sec.
2024-08-31 12:59:12 00293_shard_max_subquery_depth: [ OK ] 0.27 sec.
2024-08-31 12:59:12 00296_url_parameters: [ OK ] 0.28 sec.
2024-08-31 12:59:12 00292_parser_tuple_element: [ OK ] 0.20 sec.
2024-08-31 12:59:12 00386_long_in_pk: [ OK ] 7.46 sec.
2024-08-31 12:59:12 00280_hex_escape_sequence: [ OK ] 0.21 sec.
2024-08-31 12:59:12 00287_column_const_with_nan: [ OK ] 0.23 sec.
2024-08-31 12:59:12 00313_const_totals_extremes: [ OK ] 1.47 sec.
2024-08-31 12:59:12 00277_array_filter: [ OK ] 0.22 sec.
2024-08-31 12:59:13 00278_insert_already_sorted: [ OK ] 0.50 sec.
2024-08-31 12:59:13 00271_agg_state_and_totals: [ OK ] 0.22 sec.
2024-08-31 12:59:13 00273_quantiles: [ OK ] 0.36 sec.
2024-08-31 12:59:13 00268_aliases_without_as_keyword: [ OK ] 0.21 sec.
2024-08-31 12:59:13 00275_shard_quantiles_weighted: [ OK ] 0.50 sec.
2024-08-31 12:59:13 00267_tuple_array_access_operators_priority: [ OK ] 0.24 sec.
2024-08-31 12:59:13 00266_read_overflow_mode: [ OK ] 0.23 sec.
2024-08-31 12:59:13 00262_alter_alias: [ OK ] 0.28 sec.
2024-08-31 12:59:13 00263_merge_aggregates_and_overflow: [ OK ] 0.33 sec.
2024-08-31 12:59:13 00260_like_and_curly_braces: [ OK ] 0.30 sec.
2024-08-31 12:59:13 00310_tskv: [ OK ] 2.23 sec.
2024-08-31 12:59:13 00276_sample: [ OK ] 1.04 sec.
2024-08-31 12:59:13 00258_materializing_tuples: [ OK ] 0.26 sec.
2024-08-31 12:59:13 00252_shard_global_in_aggregate_function: [ OK ] 0.25 sec.
2024-08-31 12:59:14 00251_has_types: [ OK ] 0.25 sec.
2024-08-31 12:59:14 00239_type_conversion_in_in: [ OK ] 0.22 sec.
2024-08-31 12:59:14 00234_disjunctive_equality_chains_optimization: [ OK ] 0.25 sec.
2024-08-31 12:59:14 00232_format_readable_decimal_size: [ OK ] 0.20 sec.
2024-08-31 12:59:14 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 0.31 sec.
2024-08-31 12:59:14 00231_format_vertical_raw: [ OK ] 0.21 sec.
2024-08-31 12:59:14 00240_replace_substring_loop: [ OK ] 0.57 sec.
2024-08-31 12:59:14 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 0.31 sec.
2024-08-31 12:59:14 00229_prewhere_column_missing: [ OK ] 0.30 sec.
2024-08-31 12:59:14 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 0.27 sec.
2024-08-31 12:59:14 00227_quantiles_timing_arbitrary_order: [ OK ] 0.22 sec.
2024-08-31 12:59:14 00224_shard_distributed_aggregation_memory_efficient_and_overflows: [ OK ] 0.35 sec.
2024-08-31 12:59:14 00218_like_regexp_newline: [ OK ] 0.23 sec.
2024-08-31 12:59:14 00217_shard_global_subquery_columns_with_same_name: [ OK ] 0.24 sec.
2024-08-31 12:59:14 00215_primary_key_order_zookeeper_long: [ OK ] 0.33 sec.
2024-08-31 12:59:14 00213_multiple_global_in: [ OK ] 0.23 sec.
2024-08-31 12:59:15 00265_http_content_type_format_timezone: [ OK ] 1.63 sec.
2024-08-31 12:59:15 00209_insert_select_extremes: [ OK ] 0.25 sec.
2024-08-31 12:59:15 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 0.24 sec.
2024-08-31 12:59:15 00204_extract_url_parameter: [ OK ] 0.21 sec.
2024-08-31 12:59:15 00205_scalar_subqueries: [ OK ] 0.33 sec.
2024-08-31 12:59:15 00197_if_fixed_string: [ OK ] 0.23 sec.
2024-08-31 12:59:15 00196_float32_formatting: [ OK ] 0.23 sec.
2024-08-31 12:59:15 00199_ternary_operator_type_check: [ OK ] 0.39 sec.
2024-08-31 12:59:15 00195_shard_union_all_and_global_in: [ OK ] 0.25 sec.
2024-08-31 12:59:15 00192_least_greatest: [ OK ] 0.28 sec.
2024-08-31 12:59:15 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.21 sec.
2024-08-31 12:59:15 00191_aggregating_merge_tree_and_final: [ OK ] 0.30 sec.
2024-08-31 12:59:15 00185_array_literals: [ OK ] 0.27 sec.
2024-08-31 12:59:15 00180_attach_materialized_view: [ OK ] 0.22 sec.
2024-08-31 12:59:16 00181_aggregate_functions_statistics_stable: [ OK ] 0.38 sec.
2024-08-31 12:59:16 00178_query_datetime64_index: [ OK ] 0.21 sec.
2024-08-31 12:59:16 00210_insert_select_extremes_http: [ OK ] 1.46 sec.
2024-08-31 12:59:16 00172_constexprs_in_set: [ OK ] 0.25 sec.
2024-08-31 12:59:16 00173_compare_date_time_with_constant_string: [ OK ] 0.41 sec.
2024-08-31 12:59:16 00169_join_constant_keys: [ OK ] 0.26 sec.
2024-08-31 12:59:16 00165_transform_non_const_default: [ OK ] 0.24 sec.
2024-08-31 12:59:16 00164_not_chain: [ OK ] 0.22 sec.
2024-08-31 12:59:16 00159_whitespace_in_columns_list: [ OK ] 0.23 sec.
2024-08-31 12:59:17 00161_rounding_functions: [ OK ] 0.46 sec.
2024-08-31 12:59:17 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.21 sec.
2024-08-31 12:59:17 00154_shard_distributed_with_distinct: [ OK ] 0.22 sec.
2024-08-31 12:59:17 00177_inserts_through_http_parts: [ OK ] 1.43 sec.
2024-08-31 12:59:17 00152_totals_in_subquery: [ OK ] 0.22 sec.
2024-08-31 12:59:17 00151_tuple_with_array: [ OK ] 0.21 sec.
2024-08-31 12:59:17 00149_function_url_hash: [ OK ] 0.25 sec.
2024-08-31 12:59:18 00147_alter_nested_default: [ OK ] 0.30 sec.
2024-08-31 12:59:18 00143_number_classification_functions: [ OK ] 0.27 sec.
2024-08-31 12:59:18 00141_parse_timestamp_as_datetime: [ OK ] 0.23 sec.
2024-08-31 12:59:18 00136_duplicate_order_by_elems: [ OK ] 0.22 sec.
2024-08-31 12:59:19 00135_duplicate_group_by_keys_segfault: [ OK ] 0.18 sec.
2024-08-31 12:59:19 00223_shard_distributed_aggregation_memory_efficient: [ OK ] 4.70 sec.
2024-08-31 12:59:19 00134_aggregation_by_fixed_string_of_size_1_2_4_8: [ OK ] 0.22 sec.
2024-08-31 12:59:19 00131_set_hashed: [ OK ] 0.23 sec.
2024-08-31 12:59:19 00129_quantile_timing_weighted: [ OK ] 0.24 sec.
2024-08-31 12:59:19 00148_summing_merge_tree_aggregate_function: [ OK ] 2.02 sec.
2024-08-31 12:59:19 00127_group_by_concat: [ OK ] 0.20 sec.
2024-08-31 12:59:19 00125_array_element_of_array_of_tuple: [ OK ] 0.24 sec.
2024-08-31 12:59:19 00122_join_with_subquery_with_subquery: [ OK ] 0.22 sec.
2024-08-31 12:59:19 00120_join_and_group_by: [ OK ] 0.23 sec.
2024-08-31 12:59:19 00160_merge_and_index_in_in: [ OK ] 3.36 sec.
2024-08-31 12:59:20 00118_storage_join: [ OK ] 0.27 sec.
2024-08-31 12:59:20 00114_float_type_result_of_division: [ OK ] 0.21 sec.
2024-08-31 12:59:20 00116_storage_set: [ OK ] 0.29 sec.
2024-08-31 12:59:20 00105_shard_collations: [ OK ] 0.33 sec.
2024-08-31 12:59:20 00104_totals_having_mode: [ OK ] 0.26 sec.
2024-08-31 12:59:21 00102_insert_into_temporary_table: [ OK ] 0.21 sec.
2024-08-31 12:59:21 00109_shard_totals_after_having: [ OK ] 1.09 sec.
2024-08-31 12:59:21 00101_materialized_views_and_insert_without_explicit_database: [ OK ] 0.43 sec.
2024-08-31 12:59:21 00113_shard_group_array: [ OK ] 1.68 sec.
2024-08-31 12:59:21 00098_g_union_all: [ OK ] 0.20 sec.
2024-08-31 12:59:21 00098_6_union_all: [ OK ] 0.18 sec.
2024-08-31 12:59:21 00098_l_union_all: [ OK ] 0.25 sec.
2024-08-31 12:59:22 00098_7_union_all: [ OK ] 0.21 sec.
2024-08-31 12:59:22 00098_shard_i_union_all: [ OK ] 0.31 sec.
2024-08-31 12:59:22 00098_j_union_all: [ OK ] 0.22 sec.
2024-08-31 12:59:22 00098_a_union_all: [ OK ] 0.21 sec.
2024-08-31 12:59:22 00098_k_union_all: [ OK ] 0.23 sec.
2024-08-31 12:59:22 00098_1_union_all: [ OK ] 0.23 sec.
2024-08-31 12:59:22 00098_f_union_all: [ OK ] 0.22 sec.
2024-08-31 12:59:23 00100_subquery_table_identifier: [ OK ] 2.29 sec.
2024-08-31 12:59:23 00088_distinct_of_arrays_of_strings: [ OK ] 0.20 sec.
2024-08-31 12:59:24 00086_concat_nary_const_with_nonconst_segfault: [ OK ] 0.33 sec.
2024-08-31 12:59:24 00085_visible_width_of_tuple_of_dates: [ OK ] 0.21 sec.
2024-08-31 12:59:24 00084_summing_merge_tree: [ OK ] 0.30 sec.
2024-08-31 12:59:24 00082_append_trailing_char_if_absent: [ OK ] 0.23 sec.
2024-08-31 12:59:25 00080_show_tables_and_system_tables: [ OK ] 0.28 sec.
2024-08-31 12:59:25 00077_set_keys_fit_128_bits_many_blocks: [ OK ] 0.20 sec.
2024-08-31 12:59:25 00111_shard_external_sort_distributed: [ OK ] 5.31 sec.
2024-08-31 12:59:25 00075_shard_formatting_negate_of_negative_literal: [ OK ] 0.21 sec.
2024-08-31 12:59:25 00073_merge_sorting_empty_array_joined: [ OK ] 0.21 sec.
2024-08-31 12:59:25 00072_in_types: [ OK ] 0.20 sec.
2024-08-31 12:59:25 00071_insert_fewer_columns: [ OK ] 0.22 sec.
2024-08-31 12:59:26 00069_date_arithmetic: [ OK ] 0.23 sec.
2024-08-31 12:59:26 00066_group_by_in: [ OK ] 0.22 sec.
2024-08-31 12:59:26 00065_shard_float_literals_formatting: [ OK ] 0.22 sec.
2024-08-31 12:59:26 00064_negate_bug: [ OK ] 0.20 sec.
2024-08-31 12:59:26 00063_check_query: [ OK ] 0.26 sec.
2024-08-31 12:59:26 00061_merge_tree_alter: [ OK ] 0.38 sec.
2024-08-31 12:59:27 00062_replicated_merge_tree_alter_zookeeper_long: [ OK ] 0.75 sec.
2024-08-31 12:59:27 00060_date_lut: [ OK ] 0.20 sec.
2024-08-31 12:59:27 00059_shard_global_in: [ OK ] 0.25 sec.
2024-08-31 12:59:27 00059_shard_global_in_mergetree: [ OK ] 0.32 sec.
2024-08-31 12:59:27 00055_join_two_numbers: [ OK ] 0.20 sec.
2024-08-31 12:59:27 00328_long_case_construction: [ OK ] 17.10 sec.
2024-08-31 12:59:27 00054_join_string: [ OK ] 0.21 sec.
2024-08-31 12:59:27 00053_all_inner_join: [ OK ] 0.20 sec.
2024-08-31 12:59:27 00052_all_left_join: [ OK ] 0.22 sec.
2024-08-31 12:59:27 00050_any_left_join: [ OK ] 0.24 sec.
2024-08-31 12:59:28 00048_a_stored_aggregates_merge: [ OK ] 0.30 sec.
2024-08-31 12:59:28 00048_b_stored_aggregates_merge: [ OK ] 0.28 sec.
2024-08-31 12:59:28 00045_sorting_by_fixed_string_descending: [ OK ] 0.22 sec.
2024-08-31 12:59:28 00038_totals_limit: [ OK ] 0.23 sec.
2024-08-31 12:59:28 00041_aggregation_remap: [ OK ] 0.27 sec.
2024-08-31 12:59:28 00041_big_array_join: [ OK ] 0.34 sec.
2024-08-31 12:59:28 00034_fixed_string_to_number: [ OK ] 0.21 sec.
2024-08-31 12:59:28 00037_totals_limit: [ OK ] 0.24 sec.
2024-08-31 12:59:28 00033_fixed_string_to_string: [ OK ] 0.20 sec.
2024-08-31 12:59:28 00028_shard_big_agg_aj_distributed: [ OK ] 0.26 sec.
2024-08-31 12:59:28 00030_alter_table: [ OK ] 0.34 sec.
2024-08-31 12:59:29 00024_unused_array_join_in_subquery: [ OK ] 0.23 sec.
2024-08-31 12:59:29 00022_func_higher_order_and_constants: [ OK ] 0.23 sec.
2024-08-31 12:59:29 00014_select_from_table_with_nested: [ OK ] 0.24 sec.
2024-08-31 12:59:29 00009_array_join_subquery: [ OK ] 0.21 sec.
2024-08-31 12:59:29 00008_array_join: [ OK ] 0.22 sec.
2024-08-31 12:59:29 00007_array: [ OK ] 0.23 sec.
2024-08-31 12:59:29 00004_shard_format_ast_and_remote_table: [ OK ] 0.25 sec.
2024-08-31 12:59:29 00003_reinterpret_as_string: [ OK ] 0.23 sec.
2024-08-31 12:59:29
2024-08-31 12:59:29 368 tests passed. 1 tests skipped. 522.94 s elapsed (ForkPoolWorker-3).
2024-08-31 12:59:30 00002_system_numbers: [ OK ] 0.26 sec.
2024-08-31 12:59:30
2024-08-31 12:59:30 380 tests passed. 1 tests skipped. 523.20 s elapsed (ForkPoolWorker-5).
2024-08-31 12:59:32 00090_union_race_conditions_1: [ OK ] 9.76 sec.
2024-08-31 12:59:32
2024-08-31 12:59:32 395 tests passed. 1 tests skipped. 525.62 s elapsed (ForkPoolWorker-6).
2024-08-31 12:59:32 00029_test_zookeeper_optimize_exception: [ OK ] 4.00 sec.
2024-08-31 12:59:32
2024-08-31 12:59:32 385 tests passed. 5 tests skipped. 525.68 s elapsed (ForkPoolWorker-8).
2024-08-31 12:59:33 00097_long_storage_buffer_race_condition: [ OK ] 10.48 sec.
2024-08-31 12:59:33
2024-08-31 12:59:33 Having 1 errors! 369 tests passed. 3 tests skipped. 526.23 s elapsed (ForkPoolWorker-4).
2024-08-31 12:59:39 00183_skip_unavailable_shards: [ OK ] 24.24 sec.
2024-08-31 12:59:39
2024-08-31 12:59:39 345 tests passed. 4 tests skipped. 532.98 s elapsed (ForkPoolWorker-7).
2024-08-31 13:00:53 00155_long_merges: [ OK ] 96.37 sec.
2024-08-31 13:00:53
2024-08-31 13:00:53 390 tests passed. 3 tests skipped. 606.46 s elapsed (ForkPoolWorker-2).
2024-08-31 13:01:59 01111_create_drop_replicated_db_stress: [ OK ] 329.21 sec.
2024-08-31 13:01:59
2024-08-31 13:01:59 213 tests passed. 0 tests skipped. 672.64 s elapsed (ForkPoolWorker-9).
2024-08-31 13:01:59
2024-08-31 13:01:59 Running 302 stateless tests (MainProcess).
2024-08-31 13:01:59
2024-08-31 13:01:59 03171_hashed_dictionary_short_circuit_bug_fix: [ OK ] 0.23 sec.
2024-08-31 13:02:09 03002_part_log_rmt_fetch_mutate_error: [ OK ] 9.72 sec.
2024-08-31 13:02:09 02990_rmt_replica_path_uuid: [ OK ] 0.31 sec.
2024-08-31 13:02:11 02980_dist_insert_readonly_replica: [ OK ] 1.92 sec.
2024-08-31 13:02:14 02973_backup_of_in_memory_compressed: [ OK ] 2.46 sec.
2024-08-31 13:02:16 02971_analyzer_remote_id: [ OK ] 2.29 sec.
2024-08-31 13:03:27 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 70.63 sec.
2024-08-31 13:03:27 02960_partition_by_udf: [ OK ] 0.25 sec.
2024-08-31 13:03:33 02944_dynamically_change_filesystem_cache_size: [ OK ] 6.07 sec.
2024-08-31 13:03:37 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 3.80 sec.
2024-08-31 13:03:37 02931_max_num_to_warn: [ OK ] 0.32 sec.
2024-08-31 13:03:42 02916_move_partition_inactive_replica: [ OK ] 4.30 sec.
2024-08-31 13:03:46 02915_move_partition_inactive_replica: [ OK ] 4.69 sec.
2024-08-31 13:03:47 02911_row_policy_on_cluster: [ OK ] 0.50 sec.
2024-08-31 13:03:47 02910_prefetch_unexpceted_exception: [ OK ] 0.25 sec.
2024-08-31 13:03:47 02908_empty_named_collection: [ OK ] 0.19 sec.
2024-08-31 13:04:03 02908_many_requests_to_system_replicas: [ OK ] 5.81 sec.
2024-08-31 13:04:07 02888_replicated_merge_tree_creation: [ OK ] 3.44 sec.
2024-08-31 13:04:07 02887_insert_quorum_wo_keeper_retries: [ OK ] 0.30 sec.
2024-08-31 13:04:10 02884_async_insert_native_protocol_3: [ OK ] 2.69 sec.
2024-08-31 13:04:10 02884_async_insert_skip_settings: [ OK ] 0.63 sec.
2024-08-31 13:04:18 02871_peak_threads_usage: [ OK ] 7.89 sec.
2024-08-31 13:04:20 02867_page_cache: [ OK ] 1.56 sec.
2024-08-31 13:04:20 02867_create_user_ssh: [ OK ] 0.22 sec.
2024-08-31 13:04:20 02863_delayed_source_with_totals_and_extremes: [ OK ] 0.28 sec.
2024-08-31 13:04:22 02843_insertion_table_schema_infer: [ OK ] 1.55 sec.
2024-08-31 13:04:23 02841_parquet_filter_pushdown: [ OK ] 1.33 sec.
2024-08-31 13:04:24 02833_multiprewhere_extra_column: [ OK ] 0.41 sec.
2024-08-31 13:04:28 02808_filesystem_cache_drop_query: [ OK ] 4.24 sec.
2024-08-31 13:04:29 02796_calculate_text_stack_trace: [ OK ] 0.57 sec.
2024-08-31 13:04:33 02789_filesystem_cache_alignment: [ OK ] 4.30 sec.
2024-08-31 13:04:35 02789_table_functions_errors: [ OK ] 1.98 sec.
2024-08-31 13:04:35 02782_uniq_exact_parallel_merging_bug: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 13:04:36 02775_show_columns_called_from_mysql: [ OK ] 1.47 sec.
2024-08-31 13:04:37 02762_replicated_database_no_args: [ OK ] 0.21 sec.
2024-08-31 13:04:37 02751_ip_types_aggregate_functions_states: [ OK ] 0.49 sec.
2024-08-31 13:04:40 02736_reading_and_writing_structure_fields: [ OK ] 2.47 sec.
2024-08-31 13:04:42 02735_parquet_encoder: [ OK ] 2.72 sec.
2024-08-31 13:04:44 02735_capnp_case_insensitive_names_matching: [ OK ] 1.56 sec.
2024-08-31 13:04:44 02725_url_support_virtual_column: [ OK ] 0.28 sec.
2024-08-31 13:05:10 02725_start_stop_fetches: [ OK ] 25.39 sec.
2024-08-31 13:05:10 02710_default_replicated_parameters: [ OK ] 0.25 sec.
2024-08-31 13:05:10 02706_show_columns: [ OK ] 0.44 sec.
2024-08-31 13:05:11 02703_row_policy_for_database: [ OK ] 0.53 sec.
2024-08-31 13:05:22 02700_s3_part_INT_MAX: [ OK ] 11.27 sec.
2024-08-31 13:05:22 02581_share_big_sets_between_mutation_tasks_long: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 13:05:23 02572_system_logs_materialized_views_ignore_errors: [ OK ] 0.56 sec.
2024-08-31 13:05:27 02566_ipv4_ipv6_binary_formats: [ OK ] 4.44 sec.
2024-08-31 13:05:29 02561_temporary_table_sessions: [ OK ] 1.40 sec.
2024-08-31 13:05:30 02541_arrow_duration_type: [ OK ] 1.70 sec.
2024-08-31 13:05:43 02535_max_parallel_replicas_custom_key: [ OK ] 12.99 sec.
2024-08-31 13:05:45 02522_avro_complicate_schema: [ OK ] 1.72 sec.
2024-08-31 13:06:06 02515_cleanup_async_insert_block_ids: [ OK ] 21.06 sec.
2024-08-31 13:06:08 02510_orc_map_indexes: [ OK ] 1.50 sec.
2024-08-31 13:06:11 02504_regexp_dictionary_ua_parser: [ OK ] 2.83 sec.
2024-08-31 13:06:14 02503_insert_storage_snapshot: [ OK ] 3.31 sec.
2024-08-31 13:06:16 02503_cache_on_write_with_small_segment_size: [ OK ] 2.60 sec.
2024-08-31 13:06:18 02501_deep_recusion_schema_inference: [ OK ] 1.84 sec.
2024-08-31 13:06:30 02497_trace_events_stress_long: [ OK ] 11.62 sec.
2024-08-31 13:06:30 02495_s3_filter_by_file: [ OK ] 0.33 sec.
2024-08-31 13:06:31 02494_query_cache_compression: [ OK ] 0.25 sec.
2024-08-31 13:06:31 02494_query_cache_events: [ OK ] 0.41 sec.
2024-08-31 13:06:31 02494_query_cache_user_quotas_after_drop: [ OK ] 0.25 sec.
2024-08-31 13:06:31 02494_query_cache_use_database: [ OK ] 0.25 sec.
2024-08-31 13:06:32 02494_query_cache_bugs: [ OK ] 0.25 sec.
2024-08-31 13:06:32 02494_query_cache_case_agnostic_matching: [ OK ] 0.44 sec.
2024-08-31 13:06:32 02494_query_cache_exception_handling: [ OK ] 0.19 sec.
2024-08-31 13:06:35 02494_trace_log_profile_events: [ OK ] 2.69 sec.
2024-08-31 13:06:35 02494_query_cache_totals_extremes: [ OK ] 0.25 sec.
2024-08-31 13:06:42 02494_query_cache_ttl_long: [ OK ] 6.27 sec.
2024-08-31 13:06:42 02494_query_cache_query_log: [ OK ] 0.66 sec.
2024-08-31 13:06:43 02494_query_cache_squash_partial_results: [ OK ] 0.29 sec.
2024-08-31 13:06:43 02494_query_cache_eligible_queries: [ OK ] 0.31 sec.
2024-08-31 13:06:43 02484_substitute_udf_storage_args: [ OK ] 0.24 sec.
2024-08-31 13:06:43 02483_check_virtuals_shile_using_structure_from_insertion_table: [ OK ] 0.23 sec.
2024-08-31 13:06:46 02483_capnp_decimals: [ OK ] 2.30 sec.
2024-08-31 13:06:47 02482_json_nested_arrays_with_same_keys: [ OK ] 1.50 sec.
2024-08-31 13:06:49 02481_custom_separated_and_template_with_csv_field: [ OK ] 2.10 sec.
2024-08-31 13:08:12 02481_async_insert_dedup: [ OK ] 82.58 sec.
2024-08-31 13:09:31 02481_async_insert_dedup_token: [ OK ] 78.94 sec.
2024-08-31 13:09:33 02459_glob_for_recursive_directory_traversal: [ OK ] 2.18 sec.
2024-08-31 13:09:33 02458_hdfs_cluster_schema_inference: [ OK ] 0.29 sec.
2024-08-31 13:09:33 02422_allow_implicit_no_password: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 13:09:34 02422_msgpack_uuid_wrong_column: [ OK ] 0.24 sec.
2024-08-31 13:09:40 02421_record_errors_row_by_input_format: [ OK ] 6.79 sec.
2024-08-31 13:09:41 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 0.21 sec.
2024-08-31 13:09:41 02404_schema_inference_cache_respect_format_settings: [ OK ] 0.39 sec.
2024-08-31 13:09:41 02397_system_parts_race_condition_drop_rm: [ SKIPPED ] 0.00 sec. - disabled
2024-08-31 13:09:41 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec. - disabled
2024-08-31 13:09:42 02391_recursive_buffer: [ OK ] 0.76 sec.
2024-08-31 13:09:42 02385_profile_events_overflow: [ OK ] 0.35 sec.
2024-08-31 13:09:42 02376_arrow_dict_with_string: [ OK ] 0.20 sec.
2024-08-31 13:09:44 02373_heap_buffer_overflow_in_avro: [ OK ] 1.75 sec.
2024-08-31 13:09:50 02353_compression_level: [ OK ] 6.15 sec.
2024-08-31 13:10:12 02352_rwlock: [ OK ] 22.02 sec.
2024-08-31 13:10:13 02350_views_max_insert_threads: [ OK ] 0.39 sec.
2024-08-31 13:10:13 02346_additional_filters_distr: [ OK ] 0.23 sec.
2024-08-31 13:10:15 02337_drop_filesystem_cache_access: [ OK ] 2.08 sec.
2024-08-31 13:10:15 02323_null_modifier_in_table_function: [ OK ] 0.23 sec.
2024-08-31 13:10:16 02313_avro_records_and_maps: [ OK ] 0.28 sec.
2024-08-31 13:10:18 02311_system_zookeeper_insert_priv: [ OK ] 1.99 sec.
2024-08-31 13:10:18 02304_orc_arrow_parquet_string_as_string: [ OK ] 0.25 sec.
2024-08-31 13:10:30 02294_overcommit_overflow: [ OK ] 12.07 sec.
2024-08-31 13:10:49 02286_mysql_dump_input_format: [ OK ] 19.08 sec.
2024-08-31 13:10:52 02262_column_ttl: [ OK ] 2.45 sec.
2024-08-31 13:10:58 02247_written_bytes_quota: [ OK ] 6.44 sec.
2024-08-31 13:11:04 02247_read_bools_as_numbers_json: [ OK ] 5.51 sec.
2024-08-31 13:11:04 02244_lowcardinality_hash_join: [ OK ] 0.24 sec.
2024-08-31 13:11:16 02242_delete_user_race: [ OK ] 11.88 sec.
2024-08-31 13:11:22 02242_system_filesystem_cache_log_table: [ OK ] 5.95 sec.
2024-08-31 13:11:38 02241_filesystem_cache_on_write_operations: [ OK ] 16.55 sec.
2024-08-31 13:11:39 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 0.27 sec.
2024-08-31 13:11:47 02240_system_filesystem_cache_table: [ OK ] 8.93 sec.
2024-08-31 13:11:48 02240_filesystem_query_cache: [ OK ] 0.26 sec.
2024-08-31 13:16:00 02232_dist_insert_send_logs_level_hung: [ OK ] 251.96 sec.
2024-08-31 13:16:04 02228_merge_tree_insert_memory_usage: [ OK ] 4.55 sec.
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/ngpgdrhtvelocrbahzwymzxvirobathe?blockid=zltooqwecuqybcztkadhzoglklbrrmwqlommlspernrkcarzftqidowyzmyvxkwv&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/ngpgdrhtvelocrbahzwymzxvirobathe?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/hcpknsmswttewlaiazlqqisspxnlducp?blockid=ceyfguzsfryainwxcgmcofxnvupdfoneethydptquktdubeebbdfoamhqrftpkbj&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/iljculxghjaugkwtdvbwpblxrpsfdpie?blockid=qtmkcuybwbrksrbkfkdlwjqgmtgagjfqcnzqwjzrgtmwjhtoedxayutbsevahqxh&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/lykligscrmxpnjajyqmqscympujoavzz?blockid=jalsdhnwyujlwfbhcnsisoshcdmjsoavcmvavvillsuamgqreodrgsegizdnfnkm&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/kdnpnkqjayhyczmjrzfrbnwcsnxenwhr?blockid=swmsabsccgdpupaxobcutqewxfarfsgreezujsqudczzazqbcvobcsrmkvpbzmnp&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/napapkvprutxptwlfibzffgxmrrwxunl?blockid=onfdcgpwalayjkkwjtilbnbnyktwhlqlowfrjbykimgsaqolzpxvslzrtcbmenpm&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/omqqmnjlutwipgjqvvnvcifinewpbpho?blockid=sgstezbyvudclmfforbqkyndmkwbajfarlstnznvmxmwcctnvpxtlotjckotsocr&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/btuvmcwjcxfrwzjlxqzszfzweqvnziyz?blockid=ccfrcvpgvckyssqveykvphrsqlvvycvuafmvjsgeyuuuxqhajxamcscdfjagjvap&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/wcubawxjiroogfevasidydbpagnugugv?blockid=rdymbchdvwwcfmvwknszftsooqozlaqbgyanqyyhvlseuqjjricjdgeglfabugeg&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/zfoatszzasefdsbxscinavqoigbgjist?blockid=ddogdsmlropxefirjpatlwromdulemulluoqwujjnfnzrsarozrpqvnadsgqqnvb&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/hcpknsmswttewlaiazlqqisspxnlducp?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/iljculxghjaugkwtdvbwpblxrpsfdpie?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/lykligscrmxpnjajyqmqscympujoavzz?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/kdnpnkqjayhyczmjrzfrbnwcsnxenwhr?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/napapkvprutxptwlfibzffgxmrrwxunl?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/omqqmnjlutwipgjqvvnvcifinewpbpho?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/btuvmcwjcxfrwzjlxqzszfzweqvnziyz?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/wcubawxjiroogfevasidydbpagnugugv?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "PUT /devstoreaccount1/cont/zfoatszzasefdsbxscinavqoigbgjist?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "GET /devstoreaccount1/cont/iljculxghjaugkwtdvbwpblxrpsfdpie HTTP/1.1" 206 62
127.0.0.1 - - [31/Aug/2024:11:16:11 +0000] "GET /devstoreaccount1/cont/hcpknsmswttewlaiazlqqisspxnlducp HTTP/1.1" 206 99725
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/fanirjcdtyyeqznoezacqjvxnnbuncnl?blockid=inpqkxavbedfptthminuhhdfwppgvwutvmupsiintvfwcvbnqkcuwdycgsfosrnm&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/gtajybkejxrdmpwpveqfwgzhalahvdce?blockid=cigbvxsdizebhkgldssylsjedipggrbtxovbdxctmkzofejafoocxwnvlnwcfowe&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/vfdzbmfvxlgqgsizovojfalxynrftnec?blockid=chenngxnldkqczxfccawoxztgwhjpdfvkrzxmabfhpkfxbeawcwzjitxktxgdalz&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/wqhttguzlrzliuaiacxcjlxcywrzhhqg?blockid=hmrsidpsjovhnlcogiscaltbmicfocduazgpyzzmodamdywphpibgkmtxvvxfewu&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/mzioxcavhymjdjxzwejziseahezchlso?blockid=lqainnpsoarqjdhyueytekfnhvjbckwoshlxdbuzkfddhyxjayqlyvbbgkezxycv&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/lpgspjlylixjisstqxvawzhfhvjeabud HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/qgxedbadnrotywvmhktiouoeeoiidwwq HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/ixsneufldymddbvklhlbfqfsrffruaku HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/fanirjcdtyyeqznoezacqjvxnnbuncnl?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/gtajybkejxrdmpwpveqfwgzhalahvdce?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/vfdzbmfvxlgqgsizovojfalxynrftnec?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/wqhttguzlrzliuaiacxcjlxcywrzhhqg?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/mzioxcavhymjdjxzwejziseahezchlso?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/zfoatszzasefdsbxscinavqoigbgjist HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/omqqmnjlutwipgjqvvnvcifinewpbpho HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/kdnpnkqjayhyczmjrzfrbnwcsnxenwhr HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/iljculxghjaugkwtdvbwpblxrpsfdpie HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/hcpknsmswttewlaiazlqqisspxnlducp HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/lykligscrmxpnjajyqmqscympujoavzz HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/napapkvprutxptwlfibzffgxmrrwxunl HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/wcubawxjiroogfevasidydbpagnugugv HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/btuvmcwjcxfrwzjlxqzszfzweqvnziyz HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/vnvkjyqbggiimlntpmoitqlvnghkfbus?blockid=yhtpkbsdxzsrfddbaqvcucwcssuhnxjjghqexzrexumvekkrmyavtyhqpkthrwcr&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/zyfbhtxyyvyqsxunyjjpccbgsthnjsbe?blockid=uelvjtepcoryshqgulagatgdjarhggcolpkdgypeiqfimcuajptystpcadeidwfs&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/rdtqaevecwvqwgsdopbunfqbjfzsdmfi?blockid=kizflaofrpmzqkhtlaxkkhoqztxuvmiihorxbjmomevwhxfctgmdspgvwxptdwdf&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/fmmlqussisdfydpthnonkmaujvlxaxap?blockid=eubsjgzmiehntfrlxrpwgiylujhtsaypxkxthzmkqcjonfjfychisfohnqgoeycq&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/kpmhiotkbrfsnqcxaykjidblmtguoozx?blockid=ddmndtvojfgydgtgeafrgceqsodjqfijnymbjrkyrwildpsaklcjfqexqyeshbix&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/xeoidikfiqxoqmguilvjreevrolkubra?blockid=zietifrbnjvbffuwflgbyzmildfsmkwkpjuivrafvsbyrxdhxyedqrvjvdnvggde&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/faackjuxxhjyrmmlwmzdddupntgkkabf?blockid=zdpswnweclunowjpimqmwatjxjcaxkzlvxnsnxfglcmtcotsgtdtcixtiwlfsfry&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/xyzphcqbkrhjbfgggjimxmsmcmibxeqz?blockid=geifrjxsvojymjptgjtbtytcjsgobcvidpjarnvxbdllpzyrsyuextkihrvqihiv&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/wbpavemxmvvdtgosjuaocmfziwlirmab?blockid=hgzvpqvsdpciftynnhwpfyovwqqjucssfjkjahfspbhjsrshemoqwgvrcrnmllbz&comp=block HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/vnvkjyqbggiimlntpmoitqlvnghkfbus?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/zyfbhtxyyvyqsxunyjjpccbgsthnjsbe?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/rdtqaevecwvqwgsdopbunfqbjfzsdmfi?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/fmmlqussisdfydpthnonkmaujvlxaxap?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/kpmhiotkbrfsnqcxaykjidblmtguoozx?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/xeoidikfiqxoqmguilvjreevrolkubra?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/faackjuxxhjyrmmlwmzdddupntgkkabf?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/xyzphcqbkrhjbfgggjimxmsmcmibxeqz?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "PUT /devstoreaccount1/cont/wbpavemxmvvdtgosjuaocmfziwlirmab?comp=blocklist HTTP/1.1" 201 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/mzioxcavhymjdjxzwejziseahezchlso HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/gtajybkejxrdmpwpveqfwgzhalahvdce HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/fanirjcdtyyeqznoezacqjvxnnbuncnl HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/qgxedbadnrotywvmhktiouoeeoiidwwq HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/lpgspjlylixjisstqxvawzhfhvjeabud HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/ixsneufldymddbvklhlbfqfsrffruaku HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/wqhttguzlrzliuaiacxcjlxcywrzhhqg HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/vfdzbmfvxlgqgsizovojfalxynrftnec HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/wbpavemxmvvdtgosjuaocmfziwlirmab HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/xeoidikfiqxoqmguilvjreevrolkubra HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/fmmlqussisdfydpthnonkmaujvlxaxap HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/zyfbhtxyyvyqsxunyjjpccbgsthnjsbe HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/vnvkjyqbggiimlntpmoitqlvnghkfbus HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/rdtqaevecwvqwgsdopbunfqbjfzsdmfi HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/kpmhiotkbrfsnqcxaykjidblmtguoozx HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/xyzphcqbkrhjbfgggjimxmsmcmibxeqz HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/faackjuxxhjyrmmlwmzdddupntgkkabf HTTP/1.1" 202 -
127.0.0.1 - - [31/Aug/2024:11:16:13 +0000] "DELETE /devstoreaccount1/cont/ngpgdrhtvelocrbahzwymzxvirobathe HTTP/1.1" 202 -
2024-08-31 13:16:13 02226_filesystem_cache_profile_events: [ OK ] 9.06 sec.
2024-08-31 13:16:15 02225_unwinder_dwarf_version: [ OK ] 1.58 sec.
2024-08-31 13:16:19 02222_create_table_without_columns_metadata: [ OK ] 4.09 sec.
2024-08-31 13:16:23 02207_allow_plaintext_and_no_password: [ OK ] 3.64 sec.
2024-08-31 13:16:25 02185_values_schema_inference: [ OK ] 2.27 sec.
2024-08-31 13:16:27 02184_ipv6_parsing: [ OK ] 1.65 sec.
2024-08-31 13:16:28 02182_json_each_row_schema_inference: [ OK ] 1.73 sec.
2024-08-31 13:16:29 02179_dict_reload_on_cluster: [ OK ] 0.35 sec.
2024-08-31 13:16:30 02177_temporary_table_current_database_http_session: [ OK ] 1.35 sec.
2024-08-31 13:16:30 02168_avro_bug: [ OK ] 0.23 sec.
2024-08-31 13:16:40 02167_format_from_file_extension: [ OK ] 9.87 sec.
2024-08-31 13:16:42 02166_arrow_dictionary_inference: [ OK ] 1.65 sec.
2024-08-31 13:16:42 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 0.33 sec.
2024-08-31 13:16:56 02152_http_external_tables_memory_tracking: [ OK ] 13.30 sec.
2024-08-31 13:17:07 02149_schema_inference: [ OK ] 11.50 sec.
2024-08-31 13:17:12 02149_schema_inference_create_table_syntax: [ OK ] 4.59 sec.
2024-08-31 13:17:12 02148_sql_user_defined_function_subquery: [ OK ] 0.25 sec.
2024-08-31 13:17:16 02130_parse_quoted_null: [ OK ] 4.44 sec.
2024-08-31 13:17:23 02129_skip_quoted_fields: [ OK ] 6.77 sec.
2024-08-31 13:17:23 02126_identity_user_defined_function: [ OK ] 0.26 sec.
2024-08-31 13:17:24 02125_recursive_sql_user_defined_functions: [ OK ] 0.27 sec.
2024-08-31 13:17:24 02125_many_mutations_2: [ SKIPPED ] 0.00 sec. - not running for current build
2024-08-31 13:17:29 02118_deserialize_whole_text: [ OK ] 5.17 sec.
2024-08-31 13:17:36 02115_write_buffers_finalize: [ OK ] 6.69 sec.
2024-08-31 13:17:38 02105_table_function_file_partiotion_by: [ OK ] 2.19 sec.
2024-08-31 13:17:40 02104_json_strings_nullable_string: [ OK ] 1.74 sec.
2024-08-31 13:17:48 02103_tsv_csv_custom_null_representation: [ OK ] 8.43 sec.
2024-08-31 13:17:48 02103_sql_user_defined_functions_composition: [ OK ] 0.21 sec.
2024-08-31 13:17:48 02101_sql_user_defined_functions_drop_if_exists: [ OK ] 0.23 sec.
2024-08-31 13:17:49 02098_sql_user_defined_functions_aliases: [ OK ] 0.22 sec.
2024-08-31 13:17:49 02096_sql_user_defined_function_alias: [ OK ] 0.19 sec.
2024-08-31 13:17:49 02096_rename_atomic_hang: [ OK ] 0.25 sec.
2024-08-31 13:17:50 02051_read_settings: [ OK ] 1.13 sec.
2024-08-31 13:17:51 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 0.59 sec.
2024-08-31 13:17:58 02026_storage_filelog_largefile: [ OK ] 7.00 sec.
2024-08-31 13:17:58 02025_dictionary_view_different_db: [ OK ] 0.27 sec.
2024-08-31 13:18:00 02015_global_in_threads: [ OK ] 2.12 sec.
2024-08-31 13:18:01 02015_column_default_dict_get_identifier: [ OK ] 0.24 sec.
2024-08-31 13:18:01 02011_dictionary_empty_attribute_list: [ OK ] 0.23 sec.
2024-08-31 13:18:05 02002_row_level_filter_bug: [ OK ] 3.94 sec.
2024-08-31 13:18:05 01999_grant_with_replace: [ OK ] 0.26 sec.
2024-08-31 13:18:05 01948_dictionary_quoted_database_name: [ OK ] 0.26 sec.
2024-08-31 13:18:08 01945_system_warnings: [ OK ] 2.20 sec.
2024-08-31 13:18:08 01915_create_or_replace_dictionary: [ OK ] 0.25 sec.
2024-08-31 13:18:08 01913_exact_rows_before_limit_full: [ OK ] 0.28 sec.
2024-08-31 13:18:08 01910_view_dictionary: [ OK ] 0.25 sec.
2024-08-31 13:18:10 01903_ssd_cache_dictionary_array_type: [ OK ] 1.59 sec.
2024-08-31 13:18:10 01902_table_function_merge_db_repr: [ OK ] 0.45 sec.
2024-08-31 13:18:12 01901_test_attach_partition_from: [ OK ] 1.13 sec.
2024-08-31 13:18:13 01889_postgresql_protocol_null_fields: [ OK ] 1.49 sec.
2024-08-31 13:18:17 01889_check_row_policy_defined_using_user_function: [ OK ] 4.25 sec.
2024-08-31 13:18:18 01870_buffer_flush: [ OK ] 0.25 sec.
2024-08-31 13:18:18 01856_create_function: [ OK ] 0.29 sec.
2024-08-31 13:18:20 01853_dictionary_cache_duplicates: [ OK ] 2.05 sec.
2024-08-31 13:18:20 01850_dist_INSERT_preserve_error: [ OK ] 0.24 sec.
2024-08-31 13:18:20 01837_database_memory_ddl_dictionaries: [ OK ] 0.24 sec.
2024-08-31 13:18:21 01821_table_comment: [ OK ] 0.22 sec.
2024-08-31 13:18:21 01785_dictionary_element_count: [ OK ] 0.31 sec.
2024-08-31 13:18:21 01778_hierarchical_dictionaries: [ OK ] 0.36 sec.
2024-08-31 13:18:22 01754_direct_dictionary_complex_key: [ OK ] 0.43 sec.
2024-08-31 13:18:22 01753_direct_dictionary_simple_key: [ OK ] 0.45 sec.
2024-08-31 13:18:22 01747_executable_pool_dictionary_implicit_key: [ OK ] 0.24 sec.
2024-08-31 13:18:23 01746_executable_pool_dictionary: [ OK ] 0.25 sec.
2024-08-31 13:18:26 01737_clickhouse_server_wait_server_pool_long: [ OK ] 3.10 sec.
2024-08-31 13:18:29 01722_long_brotli_http_compression_json_format: [ OK ] 3.44 sec.
2024-08-31 13:18:30 01721_engine_file_truncate_on_insert: [ OK ] 0.26 sec.
2024-08-31 13:18:35 01710_projection_vertical_merges: [ OK ] 5.51 sec.
2024-08-31 13:18:37 01685_ssd_cache_dictionary_complex_key: [ OK ] 1.76 sec.
2024-08-31 13:18:37 01681_cache_dictionary_simple_key: [ OK ] 0.48 sec.
2024-08-31 13:18:38 01676_range_hashed_dictionary: [ OK ] 0.42 sec.
2024-08-31 13:18:38 01676_dictget_in_default_expression: [ OK ] 0.32 sec.
2024-08-31 13:18:38 01670_dictionary_create_key_expression: [ OK ] 0.28 sec.
2024-08-31 13:18:39 01646_system_restart_replicas_smoke: [ OK ] 0.24 sec.
2024-08-31 13:18:40 01643_replicated_merge_tree_fsync_smoke: [ OK ] 0.87 sec.
2024-08-31 13:18:40 01615_random_one_shard_insertion: [ OK ] 0.33 sec.
2024-08-31 13:18:40 01603_rename_overwrite_bug: [ OK ] 0.32 sec.
2024-08-31 13:18:40 01600_multiple_left_join_with_aliases: [ OK ] 0.24 sec.
2024-08-31 13:18:59 01600_detach_permanently: [ OK ] 18.65 sec.
2024-08-31 13:19:42 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 43.21 sec.
2024-08-31 13:19:43 01575_disable_detach_table_of_dictionary: [ OK ] 0.22 sec.
2024-08-31 13:19:43 01530_drop_database_atomic_sync: [ OK ] 0.38 sec.
2024-08-31 13:19:44 01527_clickhouse_local_optimize: [ OK ] 1.48 sec.
2024-08-31 13:19:45 01526_complex_key_dict_direct_layout: [ OK ] 0.23 sec.
2024-08-31 13:19:46 01524_do_not_merge_across_partitions_select_final: [ OK ] 0.83 sec.
2024-08-31 13:19:46 01517_drop_mv_with_inner_table: [ OK ] 0.28 sec.
2024-08-31 13:19:49 01507_clickhouse_server_start_with_embedded_config: [ OK ] 3.01 sec.
2024-08-31 13:19:50 01501_cache_dictionary_all_fields: [ OK ] 0.76 sec.
2024-08-31 13:19:51 01474_executable_dictionary: [ OK ] 0.94 sec.
2024-08-31 13:19:51 01471_calculate_ttl_during_merge: [ OK ] 0.32 sec.
2024-08-31 13:20:04 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 12.57 sec.
2024-08-31 13:20:33 01459_manual_write_to_replicas: [ OK ] 29.38 sec.
2024-08-31 13:20:33 01457_create_as_table_function_structure: [ OK ] 0.27 sec.
2024-08-31 13:20:34 01456_modify_column_type_via_add_drop_update: [ OK ] 0.46 sec.
2024-08-31 13:20:34 01455_rank_correlation_spearman: [ OK ] 0.26 sec.
2024-08-31 13:21:06 01454_storagememory_data_race_challenge: [ OK ] 31.81 sec.
2024-08-31 13:21:17 01444_create_table_drop_database_race: [ OK ] 11.40 sec.
2024-08-31 13:22:33 01442_merge_detach_attach_long: [ OK ] 76.32 sec.
2024-08-31 13:22:37 01417_freeze_partition_verbose_zookeeper: [ OK ] 3.53 sec.
2024-08-31 13:22:43 01417_freeze_partition_verbose: [ OK ] 5.51 sec.
2024-08-31 13:22:59 01415_sticking_mutations: [ OK ] 16.34 sec.
2024-08-31 13:23:05 01414_mutations_and_errors_zookeeper: [ OK ] 5.74 sec.
2024-08-31 13:23:07 01410_nullable_key_more_tests: [ OK ] 2.57 sec.
2024-08-31 13:23:08 01392_column_resolve: [ OK ] 0.26 sec.
2024-08-31 13:23:08 01388_clear_all_columns: [ OK ] 0.33 sec.
2024-08-31 13:23:14 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 5.83 sec.
2024-08-31 13:23:15 01360_materialized_view_with_join_on_query_log: [ OK ] 1.70 sec.
2024-08-31 13:23:16 01356_view_threads: [ OK ] 0.30 sec.
2024-08-31 13:23:16 01355_alter_column_with_order: [ OK ] 0.24 sec.
2024-08-31 13:23:30 01338_long_select_and_alter: [ OK ] 14.33 sec.
2024-08-31 13:23:45 01338_long_select_and_alter_zookeeper: [ OK ] 14.34 sec.
2024-08-31 13:23:56 01320_create_sync_race_condition_zookeeper: [ OK ] 11.14 sec.
2024-08-31 13:24:00 01307_multiple_leaders_zookeeper: [ OK ] 3.95 sec.
2024-08-31 13:24:11 01305_replica_create_drop_zookeeper: [ OK ] 11.65 sec.
2024-08-31 13:24:44 01301_aggregate_state_exception_memory_leak: [ OK ] 32.43 sec.
2024-08-31 13:24:44 01297_create_quota: [ OK ] 0.47 sec.
2024-08-31 13:24:45 01295_create_row_policy: [ OK ] 0.29 sec.
2024-08-31 13:24:45 01294_system_distributed_on_cluster: [ OK ] 0.38 sec.
2024-08-31 13:24:45 01294_create_settings_profile: [ OK ] 0.34 sec.
2024-08-31 13:24:46 01293_system_distribution_queue: [ OK ] 0.24 sec.
2024-08-31 13:24:51 01281_group_by_limit_memory_tracking: [ OK ] 5.18 sec.
2024-08-31 13:24:51 01281_unsucceeded_insert_select_queries_counter: [ OK ] 0.31 sec.
2024-08-31 13:24:54 01280_ssd_complex_key_dictionary: [ OK ] 2.83 sec.
2024-08-31 13:24:58 01275_parallel_mv: [ OK ] 4.25 sec.
2024-08-31 13:24:59 01272_suspicious_codecs: [ OK ] 0.51 sec.
2024-08-31 13:24:59 01259_dictionary_custom_settings_ddl: [ OK ] 0.28 sec.
2024-08-31 13:24:59 01251_dict_is_in_infinite_loop: [ OK ] 0.34 sec.
2024-08-31 13:25:00 01225_drop_dictionary_as_table: [ OK ] 0.22 sec.
2024-08-31 13:25:00 01225_show_create_table_from_dictionary: [ OK ] 0.24 sec.
2024-08-31 13:25:33 01192_rename_database_zookeeper: [ OK ] 33.56 sec.
2024-08-31 13:25:34 01188_attach_table_from_path: [ OK ] 0.31 sec.
2024-08-31 13:26:01 01171_mv_select_insert_isolation_long: [ OK ] 27.17 sec.
2024-08-31 13:26:01 01164_alter_memory_database: [ OK ] 0.28 sec.
2024-08-31 13:26:02 01155_rename_move_materialized_view: [ OK ] 0.47 sec.
2024-08-31 13:27:16 01154_move_partition_long: [ OK ] 74.05 sec.
2024-08-31 13:27:16 01153_attach_mv_uuid: [ OK ] 0.39 sec.
2024-08-31 13:27:17 01148_zookeeper_path_macros_unfolding: [ OK ] 0.60 sec.
2024-08-31 13:27:17 01125_dict_ddl_cannot_add_column: [ OK ] 0.26 sec.
2024-08-31 13:27:17 01119_weird_user_names: [ OK ] 0.29 sec.
2024-08-31 13:27:18 01113_local_dictionary_type_conversion: [ OK ] 0.26 sec.
2024-08-31 13:27:18 01110_dictionary_layout_without_arguments: [ OK ] 0.23 sec.
2024-08-31 13:27:18 01103_distributed_product_mode_local_column_renames: [ OK ] 0.35 sec.
2024-08-31 13:27:31 01098_msgpack_format: [ OK ] 12.85 sec.
2024-08-31 13:27:39 01098_temporary_and_external_tables: [ OK ] 7.63 sec.
2024-08-31 13:27:39 01091_num_threads: [ OK ] 0.67 sec.
2024-08-31 13:27:45 01086_window_view_cleanup: [ OK ] 5.39 sec.
2024-08-31 13:27:47 01085_max_distributed_connections_http: [ OK ] 2.40 sec.
2024-08-31 13:28:36 01083_expressions_in_engine_arguments: [ OK ] 48.42 sec.
2024-08-31 13:28:37 01082_window_view_watch_limit: [ OK ] 0.99 sec.
2024-08-31 13:29:02 01079_parallel_alter_detach_table_zookeeper: [ OK ] 24.82 sec.
2024-08-31 13:29:09 01076_cache_dictionary_datarace_exception_ptr: [ OK ] 7.79 sec.
2024-08-31 13:29:10 01070_materialize_ttl: [ OK ] 0.45 sec.
2024-08-31 13:29:10 01070_mutations_with_dependencies: [ OK ] 0.43 sec.
2024-08-31 13:29:11 01070_modify_ttl: [ OK ] 0.45 sec.
2024-08-31 13:29:20 01069_window_view_proc_tumble_watch: [ OK ] 9.18 sec.
2024-08-31 13:29:20 01069_database_memory: [ OK ] 0.28 sec.
2024-08-31 13:29:21 01065_window_view_event_hop_watch_bounded: [ OK ] 1.15 sec.
2024-08-31 13:29:22 01060_shutdown_table_after_detach: [ OK ] 0.66 sec.
2024-08-31 13:29:22 01055_compact_parts_1: [ OK ] 0.29 sec.
2024-08-31 13:29:25 01053_ssd_dictionary: [ OK ] 2.80 sec.
2024-08-31 13:29:42 01040_dictionary_invalidate_query_switchover_long: [ OK ] 16.85 sec.
2024-08-31 13:29:47 01038_dictionary_lifetime_min_zero_sec: [ OK ] 4.81 sec.
2024-08-31 13:29:47 01036_no_superfluous_dict_reload_on_create_database: [ OK ] 0.26 sec.
2024-08-31 13:29:47 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 0.28 sec.
2024-08-31 13:29:48 01023_materialized_view_query_context: [ OK ] 0.28 sec.
2024-08-31 13:29:51 01018_ddl_dictionaries_bad_queries: [ OK ] 3.20 sec.
2024-08-31 13:30:03 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 12.37 sec.
2024-08-31 13:30:37 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 33.54 sec.
2024-08-31 13:30:52 01014_lazy_database_basic: [ OK ] 15.50 sec.
2024-08-31 13:30:55 01013_sync_replica_timeout_zookeeper: [ OK ] 3.09 sec.
2024-08-31 13:30:57 00989_parallel_parts_loading: [ OK ] 1.55 sec.
2024-08-31 13:30:58 00985_merge_stack_overflow: [ OK ] 0.67 sec.
2024-08-31 13:30:59 00971_query_id_in_logs: [ OK ] 1.55 sec.
2024-08-31 13:31:00 00963_achimbab: [ OK ] 0.40 sec.
2024-08-31 13:31:00 00950_dict_get: [ OK ] 0.47 sec.
2024-08-31 13:31:00 00910_buffer_prewhere: [ OK ] 0.23 sec.
2024-08-31 13:31:02 00877_memory_limit_for_new_delete: [ OK ] 1.88 sec.
2024-08-31 13:31:57 00840_long_concurrent_select_and_drop_deadlock: [ OK ] 54.63 sec.
2024-08-31 13:31:57 00722_inner_join: [ OK ] 0.29 sec.
2024-08-31 13:32:17 00719_parallel_ddl_db: [ OK ] 19.54 sec.
2024-08-31 13:32:17 00693_max_block_size_system_tables_columns: [ OK ] 0.32 sec.
2024-08-31 13:32:21 00623_truncate_table_throw_exception: [ OK ] 3.68 sec.
2024-08-31 13:32:21 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 0.50 sec.
2024-08-31 13:32:30 00463_long_sessions_in_http_interface: [ OK ] 8.93 sec.
2024-08-31 13:32:30 00332_quantile_timing_memory_leak: [ OK ] 0.27 sec.
2024-08-31 13:32:31 00309_formats_case_insensitive: [ OK ] 0.28 sec.
2024-08-31 13:32:37 00002_log_and_exception_messages_formatting: [ OK ] 6.65 sec.
2024-08-31 13:32:37
2024-08-31 13:32:37 296 tests passed. 6 tests skipped. 1838.35 s elapsed (MainProcess).
2024-08-31 13:32:38 Won't run stateful tests because test data wasn't loaded.
2024-08-31 13:32:38 Checking the hung queries: done
2024-08-31 13:32:38
2024-08-31 13:32:38 No queries hung.
2024-08-31 13:32:38 All tests have finished.
2024-08-31 13:32:38
2024-08-31 13:32:38 Top patterns of log messages:
2024-08-31 13:32:38
2024-08-31 13:32:38 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string
2024-08-31 13:32:38
2024-08-31 13:32:38 1. 703544 0.13 36.30 MiB 0.06 13 1751 ['Trace'] 0 Access granted: {}{}
2024-08-31 13:32:38 2. 632667 0.117 99.22 MiB 0.164 1 856 ['Trace'] 0 Query {} to stage {}{}
2024-08-31 13:32:38 3. 631520 0.116 113.30 MiB 0.187 1 854 ['Trace'] 0 Query {} from stage {} to stage {}{}
2024-08-31 13:32:38 4. 172970 0.032 15.10 MiB 0.025 1 2234 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.)
2024-08-31 13:32:38 5. 166653 0.031 5.10 MiB 0.008 1 2235 ['Trace'] 0 Aggregation method: {}
2024-08-31 13:32:38 6. 137369 0.025 10.90 MiB 0.018 1 2173 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={}
2024-08-31 13:32:38 7. 137051 0.025 6.00 MiB 0.01 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {}
2024-08-31 13:32:38 8. 118017 0.022 22.11 MiB 0.036 1 566 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {})
2024-08-31 13:32:38 9. 117969 0.022 17.66 MiB 0.029 4 564 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {}
2024-08-31 13:32:38 10. 95905 0.018 2.64 MiB 0.004 1 248 ['Debug'] 0 Processed in {} sec.
2024-08-31 13:32:38 11. 88122 0.016 6.10 MiB 0.01 1 2498 ['Trace'] 0.581 Reserved {} on local disk {}, having unreserved {}.
2024-08-31 13:32:38 12. 78866 0.015 847.19 KiB 0.001 1 2164 ['Trace'] 0 Aggregating
2024-08-31 13:32:38 13. 76168 0.014 8.52 MiB 0.014 2879 1637 ['Trace'] 0.538 Renaming temporary part {} to {} with tid {}.
2024-08-31 13:32:38 14. 70561 0.013 4.78 MiB 0.008 2864 2122 ['Trace'] 0.63 Trying to reserve {} using storage policy from min volume index {}
2024-08-31 13:32:38 15. 67155 0.012 5.29 MiB 0.009 1 540 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec.
2024-08-31 13:32:38 16. 56824 0.01 5.01 MiB 0.008 1187 531 ['Trace'] 0.999 Insert entry {} to queue with type {}
2024-08-31 13:32:38 17. 53930 0.01 11.06 MiB 0.018 3 526 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {}
2024-08-31 13:32:38 18. 53921 0.01 27.25 MiB 0.045 2 526 ['Trace'] 1 Request URI: {}
2024-08-31 13:32:38 19. 51598 0.01 1.03 MiB 0.002 2 526 ['Debug'] 0.613 Done processing query
2024-08-31 13:32:38 20. 50861 0.009 3.89 MiB 0.006 1275 1504 ['Trace'] 0.973 Part {} is not stored on zero-copy replicated disk, blobs can be removed
2024-08-31 13:32:38 21. 45805 0.008 2.13 MiB 0.004 1 581 ['Debug'] 0.204 Peak memory usage{}: {}.
2024-08-31 13:32:38 22. 45628 0.008 2.17 MiB 0.004 1460 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms
2024-08-31 13:32:38 23. 44566 0.008 6.01 MiB 0.01 947 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={})
2024-08-31 13:32:38 24. 42163 0.008 1.94 MiB 0.003 1 1637 ['Trace'] 0.168 filled checksums {}
2024-08-31 13:32:38 25. 41907 0.008 3.38 MiB 0.006 6 727 ['Debug'] 0.996 {} Authenticating user '{}' from {}
2024-08-31 13:32:38 26. 41881 0.008 4.59 MiB 0.008 6 727 ['Debug'] 0.996 {} Authenticated with global context as user {}
2024-08-31 13:32:38 27. 41832 0.008 3.59 MiB 0.006 6 723 ['Debug'] 0.996 {} Logout, user_id: {}
2024-08-31 13:32:38 28. 41473 0.008 4.43 MiB 0.007 4 564 ['Debug'] 1 {} Creating session context with user_id: {}
2024-08-31 13:32:38 29. 40221 0.007 4.01 MiB 0.007 824 33 ['Debug'] 1 Fetching part {} from {}:{}
2024-08-31 13:32:38 30. 39341 0.007 2.21 MiB 0.004 1187 531 ['Debug'] 0.999 Pulling {} entries to queue: {} - {}
2024-08-31 13:32:38 31. 39341 0.007 998.90 KiB 0.002 1187 531 ['Debug'] 0.999 Pulled {} entries to queue.
2024-08-31 13:32:38 32. 38965 0.007 1.47 MiB 0.002 911 35 ['Debug'] 0.811 Committing part {} to zookeeper
2024-08-31 13:32:38 33. 37349 0.007 1.37 MiB 0.002 908 32 ['Debug'] 0.846 Part {} committed to zookeeper
2024-08-31 13:32:38 34. 34510 0.006 4.57 MiB 0.008 1 2 ['Trace'] 1 Creating part at path {}
2024-08-31 13:32:38 35. 33851 0.006 1.19 MiB 0.002 823 37 ['Trace'] 1 Checking disk {} with type {}
2024-08-31 13:32:38 36. 33851 0.006 2.84 MiB 0.005 823 37 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select
2024-08-31 13:32:38 37. 31914 0.006 2.85 MiB 0.005 1 85 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part
2024-08-31 13:32:38 38. 31629 0.006 710.90 KiB 0.001 631 71 ['Trace'] 1 Sending part {}
2024-08-31 13:32:38 39. 31625 0.006 613.78 KiB 0.001 821 38 ['Debug'] 1 Downloading files {}
2024-08-31 13:32:38 40. 31622 0.006 2.62 MiB 0.004 821 38 ['Trace'] 1 Disk for fetch is not provided, getting disk from reservation {} with type '{}'
2024-08-31 13:32:38 41. 31618 0.006 1.39 MiB 0.002 818 38 ['Debug'] 1 Downloading part {} onto disk {}.
2024-08-31 13:32:38 42. 31614 0.006 1.66 MiB 0.003 817 38 ['Debug'] 1 Download of part {} onto disk {} finished.
2024-08-31 13:32:38 43. 31597 0.006 3.07 MiB 0.005 820 33 ['Debug'] 1 Fetched part {} from {}:{}{}
2024-08-31 13:32:38 44. 31258 0.006 1.99 MiB 0.003 95 518 ['Debug'] 1 There is no part {} in ZooKeeper, it was only in filesystem
2024-08-31 13:32:38 45. 24243 0.004 1.90 MiB 0.003 1420 190 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {}
2024-08-31 13:32:38 46. 23591 0.004 829.40 KiB 0.001 1 162 ['Trace'] 1 Keeper request. Address: {}
2024-08-31 13:32:38 47. 21830 0.004 490.32 KiB 0.001 1 1907 ['Trace'] 0 Merging aggregated data
2024-08-31 13:32:38 48. 21655 0.004 704.99 KiB 0.001 2 254 ['Trace'] 1 TCP Request. Address: {}
2024-08-31 13:32:38 49. 21650 0.004 2.05 MiB 0.003 1 254 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}.
2024-08-31 13:32:38 50. 21585 0.004 569.14 KiB 0.001 1 245 ['Debug'] 1 Done processing connection.
2024-08-31 13:32:38 51. 20871 0.004 652.22 KiB 0.001 1 62 ['Debug'] 1 Receive four letter command {}
2024-08-31 13:32:38 52. 20140 0.004 639.71 KiB 0.001 1602 264 ['Debug'] 0.006 Key condition: {}
2024-08-31 13:32:38 53. 19542 0.004 2.28 MiB 0.004 7631 16 ['Trace'] 1 Executing log entry to merge parts {} to {}
2024-08-31 13:32:38 54. 17899 0.003 2.01 MiB 0.003 1594 263 ['Debug'] 0.006 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges
2024-08-31 13:32:38 55. 16787 0.003 868.86 KiB 0.001 1374 256 ['Trace'] 0.006 Spreading mark ranges among streams (default reading)
2024-08-31 13:32:38 56. 15782 0.003 983.10 KiB 0.002 34 32 ['Debug'] 1 Part {} is rendered obsolete by fetching part {}
2024-08-31 13:32:38 57. 15624 0.003 3.15 MiB 0.005 4106 16 ['Debug'] 1 Don't have all parts (at least {} is missing) for merge {}; will try to fetch it instead. Either pool for fetches is starving, see background_fetches_pool_size, or none of active replicas has it
2024-08-31 13:32:38 58. 12206 0.002 929.93 KiB 0.001 162 1175 ['Trace'] 0.012 Used generic exclusion search over index for part {} with {} steps
2024-08-31 13:32:38 59. 11841 0.002 913.51 KiB 0.001 1 344 ['Trace'] 0 Query span trace_id for opentelemetry log: {}
2024-08-31 13:32:38 60. 11818 0.002 1.22 MiB 0.002 1 51 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {}
2024-08-31 13:32:38 61. 10313 0.002 412.92 KiB 0.001 1 580 ['Debug'] 0.583 Will use old analyzer to prepare mutation
2024-08-31 13:32:38 62. 9874 0.002 1.34 MiB 0.002 1 174 ['Trace'] 0.016 PREWHERE condition was split into {} steps: {}
2024-08-31 13:32:38 63. 8161 0.002 584.48 KiB 0.001 565 1059 ['Debug'] 0 Wrote block with ID '{}', {} rows{}
2024-08-31 13:32:38 64. 7848 0.001 1.03 MiB 0.002 1 110 ['Debug'] 0 Before join block: '{}'
2024-08-31 13:32:38 65. 7832 0.001 1.58 MiB 0.003 1 110 ['Debug'] 0 After join block: '{}'
2024-08-31 13:32:38 66. 7469 0.001 1.09 MiB 0.002 1 1246 ['Information'] 0 Done writing part of data into temporary file {}, compressed {}, uncompressed {}
2024-08-31 13:32:38 67. 7469 0.001 846.10 KiB 0.001 1 1267 ['Information'] 0 Sorting and writing part of data into temporary file {}
2024-08-31 13:32:38 68. 6750 0.001 317.92 KiB 0.001 524 606 ['Debug'] 0.885 Selected {} parts from {} to {}
2024-08-31 13:32:38 69. 6736 0.001 138.14 KiB 0 1 1684 ['Debug'] 1 Stop worker in {}
2024-08-31 13:32:38 70. 6736 0.001 210.50 KiB 0 1 1496 ['Debug'] 0.5 Spawn loader worker #{} in {}
2024-08-31 13:32:38 71. 6735 0.001 467.67 KiB 0.001 1 1377 ['Debug'] 1 Finish load job '{}' with status {}
2024-08-31 13:32:38 72. 6735 0.001 441.36 KiB 0.001 1 1377 ['Debug'] 1 Execute load job '{}' in {}
2024-08-31 13:32:38 73. 6735 0.001 461.09 KiB 0.001 1 131 ['Debug'] 0.001 Schedule load job '{}' into {}
2024-08-31 13:32:38 74. 6734 0.001 533.35 KiB 0.001 1 131 ['Debug'] 0.001 Prioritize load job '{}': {} -> {}
2024-08-31 13:32:38 75. 6715 0.001 59.02 KiB 0 2 130 ['Trace'] 0.001 No tables
2024-08-31 13:32:38 76. 6714 0.001 222.93 KiB 0 1 1488 ['Debug'] 0.5 Change current priority: {} -> {}
2024-08-31 13:32:38 77. 6672 0.001 259.50 KiB 0 524 184 ['Debug'] 0.013 Reading approx. {} rows with {} streams
2024-08-31 13:32:38 78. 6640 0.001 3.25 MiB 0.005 2 26 ['Error'] 0 Number of arguments for function {} doesn't match: passed {}, should be {}
2024-08-31 13:32:38 79. 6571 0.001 915.85 KiB 0.001 2823 572 ['Debug'] 0.963 Removing {} parts from filesystem (serially): Parts: [{}]
2024-08-31 13:32:38 80. 6521 0.001 186.39 KiB 0 260 1677 ['Trace'] 0.01 Found (LEFT) boundary mark: {}
2024-08-31 13:32:38 81. 6521 0.001 452.35 KiB 0.001 260 1677 ['Trace'] 0.01 Running binary search on index range for part {} ({} marks)
2024-08-31 13:32:38 82. 6521 0.001 193.73 KiB 0 260 1677 ['Trace'] 0.01 Found (RIGHT) boundary mark: {}
2024-08-31 13:32:38 83. 6521 0.001 201.76 KiB 0 260 1677 ['Trace'] 0.01 Found {} range in {} steps
2024-08-31 13:32:38 84. 6417 0.001 467.15 KiB 0.001 1 186 ['Trace'] 0.009 The min valid primary key position for moving to the tail of PREWHERE is {}
2024-08-31 13:32:38 85. 6393 0.001 418.29 KiB 0.001 62 26 ['Information'] 1 Fetching of part was cancelled
2024-08-31 13:32:38 86. 6329 0.001 222.50 KiB 0 1 534 ['Trace'] 0.015 Converting aggregated data to blocks
2024-08-31 13:32:38 87. 6295 0.001 665.17 KiB 0.001 1 509 ['Debug'] 0.01 Converted aggregated data to blocks. {} rows, {} in {} sec. ({:.3f} rows/sec., {}/sec.)
2024-08-31 13:32:38 88. 6215 0.001 1.22 MiB 0.002 1 512 ['Information'] 1 Removing metadata {} of dropped table {}
2024-08-31 13:32:38 89. 6215 0.001 798.66 KiB 0.001 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {}
2024-08-31 13:32:38 90. 6210 0.001 460.90 KiB 0.001 1 175 ['Debug'] 0.003 Waiting for table {} to be finally dropped
2024-08-31 13:32:38 91. 6177 0.001 211.00 KiB 0 1 95 ['Debug'] 0 Selected MergeAlgorithm: {}
2024-08-31 13:32:38 92. 6177 0.001 472.46 KiB 0.001 1 95 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {}
2024-08-31 13:32:38 93. 6153 0.001 790.54 KiB 0.001 1 95 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec.
2024-08-31 13:32:38 94. 6147 0.001 351.73 KiB 0.001 592 95 ['Trace'] 0 Merged {} parts: [{}, {}] -> {}
2024-08-31 13:32:38 95. 5993 0.001 187.59 KiB 0 1 182 ['Debug'] 0.014 min_marks_for_concurrent_read={}
2024-08-31 13:32:38 96. 5895 0.001 432.46 KiB 0.001 264 32 ['Debug'] 1 Skipping action for part {} because part {} already exists.
2024-08-31 13:32:38 97. 5874 0.001 138.49 KiB 0 69 529 ['Information','Debug'] 0.991 Checking part {}
2024-08-31 13:32:38 98. 5822 0.001 290.32 KiB 0 40 513 ['Trace'] 1 Part {} in zookeeper: {}, locally: {}
2024-08-31 13:32:38 99. 5821 0.001 227.78 KiB 0 39 34 ['Trace'] 0.998 Enqueueing {} for check after {}s
2024-08-31 13:32:38 100. 5799 0.001 328.83 KiB 0.001 35 512 ['Information'] 1 Checking if anyone has a part {} or covering part.
2024-08-31 13:32:38
2024-08-31 13:32:38
2024-08-31 13:32:38
2024-08-31 13:32:38 Top messages without format string (fmt::runtime):
2024-08-31 13:32:38
2024-08-31 13:32:38 count pattern runtime_message line
2024-08-31 13:32:38
2024-08-31 13:32:38 1. 32 CodeDBExceptionParthasalreadybee Code: 384. DB::Exception: Part 4_72_72_0 has already been assigned a merge into 4_14_74_13. (PART_IS_TEMPORARILY_LOCKED) (version 24.3.5.48.altinityfips (altinity build)) (from [::1]:41434) (comment: 01154_move_partition_long.sh) (in query: ALTER TABLE dst ('/executeQuery.cpp',218)
2024-08-31 13:32:38 2. 26 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 32 ('DROP'): DROP COLUMN c. Expected one of: ALTER command, token, OpeningRoundBracket: In scope SELECT formatQuery('ALTER TABLE a (DROP COLUMN b), DROP COLUMN c'). (SYNTAX_ERROR) (version 24.3.5.48 ('/executeQuery.cpp',218)
2024-08-31 13:32:38 3. 16 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT formatQuery(''). (SYNTAX_ERROR) (version 24.3.5.48.altinityfips (altinity build)) (from [::1]:52056) (comment: 02882_formatQuery.sql) (in query: SELECT formatQuery('');), Stack trace (when copying this ('/executeQuery.cpp',218)
2024-08-31 13:32:38 4. 11 CodeDBExceptionReceivedfromDBExc Code: 206. DB::Exception: Received from 127.1:9000. DB::Exception: No alias for subquery or table function in JOIN (set joined_subquery_requires_alias=0 to disable restriction). While processing ' view(SELECT dummy AS d1, dummy AS d2 FROM system.one)'. Sta ('/executeQuery.cpp',218)
2024-08-31 13:32:38 5. 8 CodeCoordinationExceptionFaultin Code: 999. Coordination::Exception: Fault injection before operation. (KEEPER_EXCEPTION) (version 24.3.5.48.altinityfips (altinity build)) (from [::1]:50048) (comment: 02456_keeper_retries_during_insert.sql) (in query: INSERT INTO keeper_retries_r1 SETTING ('/executeQuery.cpp',218)
2024-08-31 13:32:38 6. 8 CodeDBExceptionReceivedfromlocal Code: 242. DB::Exception: Received from localhost:9000. DB::Exception: Table is in readonly mode: replica_path=/tables/shard_1/data/replicas/read. Stack trace:
2024-08-31 13:32:38
2024-08-31 13:32:38 0. std::exception::capture() @ 0x0000000018191275
2024-08-31 13:32:38 1. ./build_docker/./base/poco/Foundation/src/ ('/executeQuery.cpp',218)
2024-08-31 13:32:38 7. 6 PocoExceptionCodeecodeNetExcepti Poco::Exception. Code: 1000, e.code() = 107, Net Exception: Socket is not connected, Stack trace (when copying this message, always include the lines below):
2024-08-31 13:32:38
2024-08-31 13:32:38 0. std::exception::capture() @ 0x0000000018191275
2024-08-31 13:32:38 1. ./build_docker/./base/poco/Foundation/src/Ex ('/Exception.cpp',222)
2024-08-31 13:32:38 8. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(1_Bool :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(1_Bool, 'Expected argument of data type real'_String) UInt8 : 3'. (FUNCTION_THROW_IF ('/executeQuery.cpp',218)
2024-08-31 13:32:38 9. 4 stdexceptionCodetypeboostwrapexc std::exception. Code: 1001, type: boost::wrapexcept, e.what() = Should start with 'MULTIPOLYGON'' in () (version 24.3.5.48.altinityfips (altinity build)) (from [::1]:46824) (comment: 00534_functions_bad_arguments7.sh) ( ('/executeQuery.cpp',218)
2024-08-31 13:32:38 10. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.3.5.48.altinityfips (altinity build)) (from [::1]:52816) (comment: 02843_backup_use_same_s3_c ('/executeQuery.cpp',218)
2024-08-31 13:32:38 11. 4 CodeDBExceptionboostwrapexceptbo Code: 1001. DB::Exception: boost::wrapexcept: Should start with 'MULTIPOLYGON'' in (). (STD_EXCEPTION) ('/TCPHandler.cpp',701)
2024-08-31 13:32:38 12. 3 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71)
2024-08-31 13:32:38 13. 2 PocoExceptionCodeecodeBadURIsynt Poco::Exception. Code: 1000, e.code() = 0, Bad URI syntax: URI contains invalid characters (version 24.3.5.48.altinityfips (altinity build)) (from [::1]:39130) (comment: 00746_sql_fuzzy.sh) (in query: SELECT * FROM hdfs('\0');), Stack trace (when copying t ('/executeQuery.cpp',218)
2024-08-31 13:32:38 14. 2 creatingasnapshotforindex creating a snapshot for index 200000 ('/LoggerWrapper.h',43)
2024-08-31 13:32:38 15. 2 CodeDBExceptionEmptyquerySYNTAXE Code: 62. DB::Exception: Empty query. (SYNTAX_ERROR) (version 24.3.5.48.altinityfips (altinity build)) (from [::ffff:127.0.0.1]:53698) (in query: ), Stack trace (when copying this message, always include the lines below):
2024-08-31 13:32:38
2024-08-31 13:32:38 0. std::exception::capture() @ 0x ('/executeQuery.cpp',218)
2024-08-31 13:32:38 16. 2 CodeDBExceptionThereisnosubtypef Code: 386. DB::Exception: There is no subtype for types String, UInt8 because some of them are String/FixedString and some of them are not: In scope SELECT ['1', '2'] AS arr1, [1, 2] AS arr2, round(arrayJaccardIndex(arr1, arr2), 2). (NO_COMMON_TYPE) (versi ('/executeQuery.cpp',218)
2024-08-31 13:32:38 17. 2 snapshotidxlogtermcreatedcompact snapshot idx 200000 log_term 1 created, compact the log store if needed ('/LoggerWrapper.h',43)
2024-08-31 13:32:38 18. 2 CodeDBExceptionSyntaxerrorcolumn Code: 62. DB::Exception: Syntax error (columns declaration list): failed at position 2 ('"c{Y>n'): "c{Y>n. Double quoted string is not closed: '"c{Y>n'. (SYNTAX_ERROR) (version 24.3.5.48.altinityfips (altinity build)) (from [::1]:39130) (comment: 00746_sql ('/executeQuery.cpp',218)
2024-08-31 13:32:38 19. 2 createsnapshotidxlogterm create snapshot idx 200000 log_term 1 ('/LoggerWrapper.h',43)
2024-08-31 13:32:38 20. 2 CodeDBExceptionCodeDBExceptionUn Code: 60. DB::Exception: Code: 60. DB::Exception: Unknown table expression identifier 'test_nd4nr8y9.table_for_dict' in scope SELECT key_column, toString(fourth_column) AS some_column, fourth_column FROM test_nd4nr8y9.table_for_dict. (UNKNOWN_TABLE) (versi ('/executeQuery.cpp',218)
2024-08-31 13:32:38 21. 2 createsnapshotidxlogtermdoneusel create snapshot idx 200000 log_term 1 done: 67 us elapsed ('/LoggerWrapper.h',43)
2024-08-31 13:32:38 22. 2 CodeDBExceptionBadURIsyntaxURIco Code: 1000. DB::Exception: Bad URI syntax: URI contains invalid characters. (POCO_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2024-08-31 13:32:38
2024-08-31 13:32:38 0. std::exception::capture() @ 0x0000000018191275
2024-08-31 13:32:38 1. ./build_docker/./base/poco/Foundati ('/TCPHandler.cpp',701)
2024-08-31 13:32:38 23. 1 FailedtomakebackupShttplocalhost Failed to make backup S3('http://localhost:11111/test/backups/test_z8ox2u0a/use_same_s3_credentials_for_base_backup_base_inc_3_bad', 'test', '[HIDDEN]'): Code: 499. DB::Exception: The request signature we calculated does not match the signature you provide ('/Exception.cpp',222)
2024-08-31 13:32:38 24. 1 CodeDBExceptionstdruntimeerrorra Code: 1001. DB::Exception: std::runtime_error: ran out of bytes. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below):
2024-08-31 13:32:38
2024-08-31 13:32:38 0. std::exception::capture() @ 0x0000000018191275
2024-08-31 13:32:38 1. ./contrib/llvm-project/libcxx/src/support/runti ('/TCPHandler.cpp',701)
2024-08-31 13:32:38 25. 1 statemachinecommitindexprecommit state machine commit index 0, precommit index 0, last log index 0 ('/LoggerWrapper.h',43)
2024-08-31 13:32:38 26. 1 ELECTIONTIMEOUTcurrentrolefollow [ELECTION TIMEOUT] current role: follower, log last term 0, state term 0, target p 1, my p 1, hb dead, pre-vote NOT done ('/LoggerWrapper.h',43)
2024-08-31 13:32:38 27. 1 stdexceptionCodetypestdruntimeer std::exception. Code: 1001, type: std::runtime_error, e.what() = ran out of bytes (version 24.3.5.48.altinityfips (altinity build)) (from [::1]:38602) (comment: 02688_aggregate_states.sql) (in query: SELECT '\x01\x01\x01'::AggregateFunction(groupBitmap, UI ('/executeQuery.cpp',218)
2024-08-31 13:32:38 28. 1 invalidelectiontimeoutupperbound invalid election timeout upper bound detected, adjusted to 0 ('/LoggerWrapper.h',43)
2024-08-31 13:32:38 29. 1 waitforHBforms wait for HB, for 50 + [0, 0] ms ('/LoggerWrapper.h',43)
2024-08-31 13:32:41 30. 1 bgappendentriesthreadinitiated bg append_entries thread initiated ('/LoggerWrapper.h',43)
2024-08-31 13:32:41
2024-08-31 13:32:41
2024-08-31 13:32:41
2024-08-31 13:32:41 Top messages not matching their format strings:
2024-08-31 13:32:41
2024-08-31 13:32:41 message_format_string count() any_message
2024-08-31 13:32:41
2024-08-31 13:32:41 1. Query {} to stage {}{} 132 Query SELECT _CAST(1, 'UInt8') AS `like('a�b', 'a%�b')` FROM system.one AS __table1 to stage Complete
2024-08-31 13:32:41 message_format_string count() any_message
2024-08-31 13:32:41
2024-08-31 13:32:41 2. Query {} from stage {} to stage {}{} 132 Query SELECT _CAST(1, 'UInt8') AS `like('a�b', 'a%�b')` FROM system.one AS __table1 from stage FetchColumns to stage Complete
2024-08-31 13:32:41 message_format_string count() any_message
2024-08-31 13:32:41
2024-08-31 13:32:41 3. 43 Forked a child process to watch
2024-08-31 13:32:41 message_format_string count() any_message
2024-08-31 13:32:41
2024-08-31 13:32:41 4. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.3.5.48.altinityfips (altinity build)) (from [::1]:51980) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below):
2024-08-31 13:32:41
2024-08-31 13:32:41 0. std::exception::capture() @ 0x0000000018191275
2024-08-31 13:32:41 1. ./build_docker/./base/poco/Foundation/src/Exception.cpp:28: Poco::Exception::Exception(String const&, int) @ 0x0000000036921c45
2024-08-31 13:32:41 2. ./build_docker/./src/Common/Exception.cpp:96: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x00000000246243cb
2024-08-31 13:32:41 3. DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x00000000192b3fdb
2024-08-31 13:32:41 4. DB::ByteJaccardIndexImpl::process(char const*, unsigned long, char const*, unsigned long) @ 0x00000000192b7d4b
2024-08-31 13:32:41 5. DB::FunctionStringDistanceImpl>::vectorVector(DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul>&) @ 0x00000000192b6c24
2024-08-31 13:32:41 6. DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x00000000192b5aa2
2024-08-31 13:32:41 7. DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000001873b4a1
2024-08-31 13:32:41 8. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000002e7e8408
2024-08-31 13:32:41 9. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000002e7e9efd
2024-08-31 13:32:41 10. ./build_docker/./src/Functions/IFunction.cpp:0: DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000002e7eb4d7
2024-08-31 13:32:41 11. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::executeAction(DB::ExpressionActions::Action const&, DB::(anonymous namespace)::ExecutionContext&, bool, bool) @ 0x000000002fd63f49
2024-08-31 13:32:41 12. ./build_docker/./src/Interpreters/ExpressionActions.cpp:0: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x000000002fd618ca
2024-08-31 13:32:41 13. ./build_docker/./src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x0000000033b05b81
2024-08-31 13:32:41 14. ./contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x0000000028f95a4b
2024-08-31 13:32:41 15. ./build_docker/./src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x00000000334edb0d
2024-08-31 13:32:41 16. ./build_docker/./src/Processors/Executors/ExecutionThreadContext.cpp:50: DB::ExecutionThreadContext::executeTask() @ 0x000000003351edb0
2024-08-31 13:32:41 17. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeSingleThread(unsigned long) @ 0x000000003350d4fb
2024-08-31 13:32:41 18. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::executeImpl(unsigned long, bool) @ 0x000000003350b2d7
2024-08-31 13:32:41 19. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x000000003350aeea
2024-08-31 13:32:41 20. ./build_docker/./src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:0: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x0000000033524571
2024-08-31 13:32:41 21. ./base/base/../base/wide_integer_impl.h:810: ThreadPoolImpl::worker(std::__list_iterator) @ 0x000000002472ff3b
2024-08-31 13:32:41 22. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15000]>, void ThreadPoolImpl::scheduleImpl(std::function, Priority, std::optional, bool)::'lambda0'()>>(void*) @ 0x0000000024734c8a
2024-08-31 13:32:41 23. ? @ 0x00007fb60a3b4ac3
2024-08-31 13:32:41 24. ? @ 0x00007fb60a446850
2024-08-31 13:32:41
2024-08-31 13:32:41 message_format_string count() any_message
2024-08-31 13:32:41
2024-08-31 13:32:41 5. (from {}{}{}){}{} {} (stage: {}) 3 (from [::1]:38662) (comment: 02687_native_fuzz.sql) -- It correctly throws exception about incorrect data instead of a low-level exception about the allocator:
2024-08-31 13:32:41 SELECT * FROM format(Native, 'WatchID Int64, JavaEnable Int16, UTMCaTitle String, GoodEvent Int16, EventTime DateTime, EventDate Date, Countem String, FromTag String, HasGCLID Int16, RefererHash Int64, URLHash Int64, CLID Int16', $$
������������������������������������������������������������������������ ��'���X+��'���X+��'���URLHashInt64�|3��b.��|3��b.��|3��b.��|3��b.��
2024-08-31 13:32:41 o���e��
�#�\X-h��X v�v����h��9�D�|3��b.�CLIDInt32 � $$); (stage: Complete)
2024-08-31 13:32:41 message_format_string count() any_message
2024-08-31 13:32:41
2024-08-31 13:32:43 6. {} is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) 1 /var/lib/clickhouse/store/dd2/dd275ee9-2aa9-460b-aba4-6cac9ee8d8cd/tmp_merge_9_98_141_8/ is in use (by merge/mutation/INSERT) (consider increasing temporary_directories_lifetime setting) (skipped 2 similar messages)
2024-08-31 13:32:43
2024-08-31 13:32:43
2024-08-31 13:32:43
2024-08-31 13:32:43 Top short messages:
2024-08-31 13:32:43
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 1. 681 {}:{}: '{}' src/Processors/Transforms/MergeJoinTransform.cpp:836: ' Nullable(size = 1, UInt32(size = 1), UInt8(size = 1)) Nullable(s 30
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 2. 16 Creating {}: {} Creating table test_35p5vz7a_2.src: CREATE TABLE IF NOT EXISTS test_35p5vz7a_2.src UUID '7ba4030e-afcd-49f7-81d8-c16ea19 124
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 3. 12 Froze {} parts Froze 1 parts -13
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 4. 12 Illegal UTF-8 sequence, while processing '{}' Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8 -1
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 5. 6 Bad SSH public key provided Code: 706. DB::Exception: Bad SSH public key provided. (LIBSSH_ERROR) (version 24.3.5.48.altinityfips (altinity build)) 29
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 6. 5 {} Server was built with sanitizer. It will work slowly. 27
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 7. 2 Path to archive is empty Code: 36. DB::Exception: Path to archive is empty. (BAD_ARGUMENTS) (version 24.3.5.48.altinityfips (altinity build)) (fr 25
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 8. 2 File must not be a directory Code: 79. DB::Exception: File must not be a directory. (INCORRECT_FILE_NAME) (version 24.3.5.48.altinityfips (altinity b 29
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 9. 2 Unknown setting '{}' Code: 115. DB::Exception: Unknown setting 'xxx_yyy'. (UNKNOWN_SETTING) (version 24.3.5.48.altinityfips (altinity build)) 27
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 10. 2 Database {} does not exist Code: 81. DB::Exception: Database `\0` does not exist. (UNKNOWN_DATABASE) (version 24.3.5.48.altinityfips (altinity buil 29
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 11. 2 Substitution {} is not set Code: 456. DB::Exception: Substitution `s` is not set. (UNKNOWN_QUERY_PARAMETER) (version 24.3.5.48.altinityfips (altini 29
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 12. 2 Invalid cache key hex: {} Code: 36. DB::Exception: Invalid cache key hex: kek. (BAD_ARGUMENTS) (version 24.3.5.48.altinityfips (altinity build)) ( 27
2024-08-31 13:32:43 c message_format_string substr(any(message), 1, 120) min_length_without_exception_boilerplate
2024-08-31 13:32:43
2024-08-31 13:32:43 13. 2 Unknown statistic column: {} Code: 708. DB::Exception: Unknown statistic column: b. (ILLEGAL_STATISTIC) (version 24.3.5.48.altinityfips (altinity bui 29
2024-08-31 13:32:43
2024-08-31 13:32:43
2024-08-31 13:32:43
2024-08-31 13:32:43 Top messages by level:
2024-08-31 13:32:43
2024-08-31 13:32:43 (1.841177455076651e-7,'Can\'t start NON-SECURE keeper server in FIPS mode, please check the config.') Fatal
2024-08-31 13:32:43 (0.0012225418301708962,'Number of arguments for function {} doesn\'t match: passed {}, should be {}') Error
2024-08-31 13:32:43 (0.000316130169036661,'Not enabled four letter command {}') Warning
2024-08-31 13:32:43 (0.0013751754411967505,'Sorting and writing part of data into temporary file {}') Information
2024-08-31 13:32:43 (0.021729760442560142,'(from {}{}{}){}{} {} (stage: {})') Debug
2024-08-31 13:32:43 (0.12953585573417228,'Access granted: {}{}') Trace
2024-08-31 13:32:43
2024-08-31 13:32:43
+ set -e
+ [[ 0 -eq 124 ]]
+ return 0
+ echo 'Files in current directory'
+ ls -la ./
Files in current directory
total 138004
drwxr-xr-x 1 root root 4096 Aug 31 13:23 .
drwxr-xr-x 1 root root 4096 Aug 31 13:23 ..
-rw-rw-r-- 1 1000 1000 312 Aug 31 12:47 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 1566 Jun 13 05:03 attach_gdb.lib
-rw-r--r-- 1 root root 1541 Aug 31 13:16 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4239 Aug 31 13:16 __azurite_db_blob__.json
-rw-r--r-- 1 root root 488347 Aug 31 13:32 azurite_log
lrwxrwxrwx 1 root root 7 Apr 27 04:02 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Aug 31 12:49 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
drwxr-xr-x 8 root root 4096 Aug 31 12:55 clickhouse-local-105915-1725101744-1303872226685093281
drwxr-x--- 4 root root 4096 Aug 31 13:16 data
drwxr-xr-x 5 root root 340 Aug 31 12:48 dev
drwxr-x--- 2 root root 4096 Aug 31 13:16 dictionaries_lib
-rwxr-xr-x 1 root root 0 Aug 31 12:48 .dockerenv
drwxr-xr-x 1 root root 4096 Aug 31 12:49 etc
drwxr-x--- 2 root root 4096 Aug 31 13:16 flags
drwxr-x--- 2 root root 4096 Aug 31 13:16 format_schemas
drwxr-xr-x 1 1000 1000 4096 Aug 31 12:49 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Apr 27 04:02 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Apr 27 04:02 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Apr 27 04:02 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Apr 27 04:02 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 21843968 Jun 13 05:04 mc
drwxr-xr-x 2 root root 4096 Apr 27 04:02 media
drwxr-x--- 2 root root 4096 Aug 31 13:16 metadata
drwxr-x--- 2 root root 4096 Aug 31 13:16 metadata_dropped
-rwxr-xr-x 1 root root 118595584 Jun 13 05:04 minio
drwxr-xr-x 4 root root 4096 Aug 31 12:49 minio_data
drwxr-xr-x 2 root root 4096 Apr 27 04:02 mnt
drwxr-x--- 2 root root 4096 Aug 31 13:16 named_collections
drwxr-xr-x 2 root root 4096 Apr 27 04:02 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Aug 31 12:48 package_folder
drwxr-x--- 2 root root 4096 Aug 31 13:18 preprocessed_configs
dr-xr-xr-x 312 root root 0 Aug 31 12:48 proc
-rwxrwxr-x 1 root root 7989 May 14 19:27 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Aug 31 12:53 queries_02352
-rw-r----- 1 root root 1 Aug 31 13:16 quotas.list
-rw-r----- 1 root root 1 Aug 31 13:16 roles.list
drwx------ 1 root root 4096 Aug 31 13:29 root
-rw-r----- 1 root root 1 Aug 31 13:16 row_policies.list
drwxr-xr-x 1 root root 4096 Aug 31 12:49 run
-rwxrwxr-x 1 root root 16095 Jun 13 05:03 run.sh
lrwxrwxrwx 1 root root 8 Apr 27 04:02 sbin -> usr/sbin
-rw-r--r-- 1 root root 462 Aug 31 12:49 script.gdb
-rw-r--r-- 1 root root 42011 Aug 31 13:19 server.log
-rw-r----- 1 root root 1 Aug 31 13:16 settings_profiles.list
-rwxrwxr-x 1 root root 10462 May 14 19:27 setup_export_logs.sh
-rwxrwxr-x 1 root root 351 Jun 13 05:03 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3464 Jun 13 05:03 setup_minio.sh
drwxr-xr-x 2 root root 4096 Apr 27 04:02 srv
-rw-r----- 1 root root 60 Aug 31 13:18 status
drwxr-x--- 4 root root 4096 Aug 31 13:16 store
-rw-rw-r-- 1 root root 13192 Jun 13 05:03 stress_tests.lib
dr-xr-xr-x 13 root root 0 Aug 31 12:48 sys
drwxrwxr-x 2 1000 1000 4096 Aug 31 12:50 test_output
drwxrwxrwt 1 root root 69632 Aug 31 13:32 tmp
drwxr-xr-x 2 root root 4096 Aug 31 12:50 user_defined
drwxr-x--- 2 root root 4096 Aug 31 13:16 user_files
drwxr-x--- 2 root root 4096 Aug 31 13:16 user_scripts
-rw-r----- 1 root root 1 Aug 31 13:16 users.list
drwxr-xr-x 1 root root 4096 Apr 27 04:02 usr
-rw-rw-r-- 1 root root 833 Jun 13 05:03 utils.lib
-rw-r----- 1 root root 36 Aug 31 13:16 uuid
drwxr-xr-x 1 root root 4096 Apr 27 04:05 var
Files in root directory
+ echo 'Files in root directory'
+ ls -la /
total 138004
drwxr-xr-x 1 root root 4096 Aug 31 13:23 .
drwxr-xr-x 1 root root 4096 Aug 31 13:23 ..
-rw-rw-r-- 1 1000 1000 312 Aug 31 12:47 analyzer_tech_debt.txt
-rw-rw-r-- 1 root root 1566 Jun 13 05:03 attach_gdb.lib
-rw-r--r-- 1 root root 1541 Aug 31 13:16 __azurite_db_blob_extent__.json
-rw-r--r-- 1 root root 4239 Aug 31 13:16 __azurite_db_blob__.json
-rw-r--r-- 1 root root 488347 Aug 31 13:32 azurite_log
lrwxrwxrwx 1 root root 7 Apr 27 04:02 bin -> usr/bin
drwxr-xr-x 2 root root 4096 Aug 31 12:49 __blobstorage__
drwxr-xr-x 2 root root 4096 Apr 18 2022 boot
drwxr-xr-x 8 root root 4096 Aug 31 12:55 clickhouse-local-105915-1725101744-1303872226685093281
drwxr-x--- 4 root root 4096 Aug 31 13:16 data
drwxr-xr-x 5 root root 340 Aug 31 12:48 dev
drwxr-x--- 2 root root 4096 Aug 31 13:16 dictionaries_lib
-rwxr-xr-x 1 root root 0 Aug 31 12:48 .dockerenv
drwxr-xr-x 1 root root 4096 Aug 31 12:49 etc
drwxr-x--- 2 root root 4096 Aug 31 13:16 flags
drwxr-x--- 2 root root 4096 Aug 31 13:16 format_schemas
drwxr-xr-x 1 1000 1000 4096 Aug 31 12:49 hadoop-3.3.1
drwxr-xr-x 2 root root 4096 Apr 18 2022 home
lrwxrwxrwx 1 root root 7 Apr 27 04:02 lib -> usr/lib
lrwxrwxrwx 1 root root 9 Apr 27 04:02 lib32 -> usr/lib32
lrwxrwxrwx 1 root root 9 Apr 27 04:02 lib64 -> usr/lib64
lrwxrwxrwx 1 root root 10 Apr 27 04:02 libx32 -> usr/libx32
-rwxr-xr-x 1 root root 21843968 Jun 13 05:04 mc
drwxr-xr-x 2 root root 4096 Apr 27 04:02 media
drwxr-x--- 2 root root 4096 Aug 31 13:16 metadata
drwxr-x--- 2 root root 4096 Aug 31 13:16 metadata_dropped
-rwxr-xr-x 1 root root 118595584 Jun 13 05:04 minio
drwxr-xr-x 4 root root 4096 Aug 31 12:49 minio_data
drwxr-xr-x 2 root root 4096 Apr 27 04:02 mnt
drwxr-x--- 2 root root 4096 Aug 31 13:16 named_collections
drwxr-xr-x 2 root root 4096 Apr 27 04:02 opt
-rw-r--r-- 1 root root 0 Feb 14 2024 .package-cache-mutate
drwxrwxr-x 2 1000 1000 4096 Aug 31 12:48 package_folder
drwxr-x--- 2 root root 4096 Aug 31 13:18 preprocessed_configs
dr-xr-xr-x 312 root root 0 Aug 31 12:48 proc
-rwxrwxr-x 1 root root 7989 May 14 19:27 process_functional_tests_result.py
-rw-r--r-- 1 root root 29 Aug 31 12:53 queries_02352
-rw-r----- 1 root root 1 Aug 31 13:16 quotas.list
-rw-r----- 1 root root 1 Aug 31 13:16 roles.list
drwx------ 1 root root 4096 Aug 31 13:29 root
-rw-r----- 1 root root 1 Aug 31 13:16 row_policies.list
drwxr-xr-x 1 root root 4096 Aug 31 12:49 run
-rwxrwxr-x 1 root root 16095 Jun 13 05:03 run.sh
lrwxrwxrwx 1 root root 8 Apr 27 04:02 sbin -> usr/sbin
-rw-r--r-- 1 root root 462 Aug 31 12:49 script.gdb
-rw-r--r-- 1 root root 42011 Aug 31 13:19 server.log
-rw-r----- 1 root root 1 Aug 31 13:16 settings_profiles.list
-rwxrwxr-x 1 root root 10462 May 14 19:27 setup_export_logs.sh
-rwxrwxr-x 1 root root 351 Jun 13 05:03 setup_hdfs_minicluster.sh
-rwxrwxr-x 1 root root 3464 Jun 13 05:03 setup_minio.sh
drwxr-xr-x 2 root root 4096 Apr 27 04:02 srv
-rw-r----- 1 root root 60 Aug 31 13:18 status
drwxr-x--- 4 root root 4096 Aug 31 13:16 store
-rw-rw-r-- 1 root root 13192 Jun 13 05:03 stress_tests.lib
dr-xr-xr-x 13 root root 0 Aug 31 12:48 sys
drwxrwxr-x 2 1000 1000 4096 Aug 31 12:50 test_output
drwxrwxrwt 1 root root 69632 Aug 31 13:32 tmp
drwxr-xr-x 2 root root 4096 Aug 31 12:50 user_defined
drwxr-x--- 2 root root 4096 Aug 31 13:16 user_files
drwxr-x--- 2 root root 4096 Aug 31 13:16 user_scripts
-rw-r----- 1 root root 1 Aug 31 13:16 users.list
drwxr-xr-x 1 root root 4096 Apr 27 04:02 usr
-rw-rw-r-- 1 root root 833 Jun 13 05:03 utils.lib
-rw-r----- 1 root root 36 Aug 31 13:16 uuid
drwxr-xr-x 1 root root 4096 Apr 27 04:05 var
+ /process_functional_tests_result.py
2024-08-31 13:32:43,067 File /analyzer_tech_debt.txt with broken tests found
2024-08-31 13:32:43,067 Broken tests in the list: 11
2024-08-31 13:32:43,067 Find files in result folder gdb.log,run.log,garbage.log,test_result.txt
2024-08-31 13:32:43,082 Is flaky check: False
2024-08-31 13:32:43,082 Result parsed
2024-08-31 13:32:43,084 Result written
+ clickhouse-client -q 'system flush logs'
Detach all logs replication
+ stop_logs_replication
+ echo 'Detach all logs replication'
+ clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')'
+ tee /dev/stderr
+ xargs -n1 -r -i clickhouse-client --query 'drop table {}'
xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value
+ failed_to_save_logs=0
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
++ zstd --threads=0
++ clickhouse-client -q 'select * from system.query_log format TSVWithNamesAndTypes'
+ err='++ zstd --threads=0
++ clickhouse-client -q '\''select * from system.query_log format TSVWithNamesAndTypes'\'''
+ echo '++ zstd --threads=0
++ clickhouse-client -q '\''select * from system.query_log format TSVWithNamesAndTypes'\'''
+ [[ 0 != \1\0\4 ]]
+ failed_to_save_logs=1
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ err='++ clickhouse-client -q '\''select * from system.zookeeper_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ echo '++ clickhouse-client -q '\''select * from system.zookeeper_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ [[ 0 != \1\0\8 ]]
+ failed_to_save_logs=1
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
++ clickhouse-client -q 'select * from system.zookeeper_log format TSVWithNamesAndTypes'
++ zstd --threads=0
+ err='++ clickhouse-client -q '\''select * from system.trace_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ echo '++ clickhouse-client -q '\''select * from system.trace_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ [[ 0 != \1\0\4 ]]
+ failed_to_save_logs=1
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
++ clickhouse-client -q 'select * from system.trace_log format TSVWithNamesAndTypes'
++ zstd --threads=0
++ clickhouse-client -q 'select * from system.transactions_info_log format TSVWithNamesAndTypes'
++ zstd --threads=0
+ err='++ clickhouse-client -q '\''select * from system.transactions_info_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ echo '++ clickhouse-client -q '\''select * from system.transactions_info_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ [[ 0 != \1\1\6 ]]
+ failed_to_save_logs=1
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ err='++ clickhouse-client -q '\''select * from system.metric_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ echo '++ clickhouse-client -q '\''select * from system.metric_log format TSVWithNamesAndTypes'\''
++ zstd --threads=0'
+ [[ 0 != \1\0\5 ]]
+ failed_to_save_logs=1
+ [[ -n '' ]]
+ sudo clickhouse stop
++ clickhouse-client -q 'select * from system.metric_log format TSVWithNamesAndTypes'
++ zstd --threads=0
script.gdb:13: Error in sourced command file:
No stack.
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 728.
The process with pid = 728 is running.
Sent terminate signal to process with pid 728.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 728.
The process with pid = 728 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 728.
The process with pid = 728 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 728.
The process with pid = 728 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 728.
The process with pid = 728 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 728.
The process with pid = 728 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 728.
The process with pid = 728 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 728.
The process with pid = 728 is running.
Waiting for server to stop
/var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 728.
The process with pid = 728 does not exist.
Server stopped
+ [[ -n '' ]]
+ rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log
2024.08.31 12:49:56.385502 [ 728 ] {} KeeperServer: Can't start NON-SECURE keeper server in FIPS mode, please check the config.
+ rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log
+ :
+ data_path_config=--path=/var/lib/clickhouse/
+ [[ -n '' ]]
+ zstd --threads=0
+ '[' 1 -ne 0 ']'
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables --stacktrace -q 'select * from system.query_log format TSVWithNamesAndTypes'
+ zstd --threads=0
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ zstd --threads=0
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables --stacktrace -q 'select * from system.zookeeper_log format TSVWithNamesAndTypes'
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables --stacktrace -q 'select * from system.trace_log format TSVWithNamesAndTypes'
+ zstd --threads=0
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables --stacktrace -q 'select * from system.transactions_info_log format TSVWithNamesAndTypes'
+ zstd --threads=0
+ [[ -n '' ]]
+ for table in query_log zookeeper_log trace_log transactions_info_log metric_log
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables --stacktrace -q 'select * from system.metric_log format TSVWithNamesAndTypes'
+ zstd --threads=0
+ [[ -n '' ]]
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''CPU'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Memory'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
+ zstd --threads=0
format TabSeparated'
+ for trace_type in CPU Memory Real
+ clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q '
select
arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack,
count(*) AS samples
from system.trace_log
where trace_type = '\''Real'\''
group by trace
order by samples desc
settings allow_introspection_functions = 1
format TabSeparated'
+ zstd --threads=0
+ rm /var/log/clickhouse-server/clickhouse-server.log
+ mv /var/log/clickhouse-server/stderr.log /test_output/
+ [[ -n '' ]]
+ tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination
tar: Removing leading `/' from member names
tar: Removing leading `/' from hard link targets
+ [[ -n '' ]]